Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1011036..1011571 | Replicon | chromosome |
Accession | NZ_CP110130 | ||
Organism | Methylorubrum extorquens strain NBC_00404 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | OKC48_RS04725 | Protein ID | WP_265245068.1 |
Coordinates | 1011281..1011571 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | OKC48_RS04720 | Protein ID | WP_265222623.1 |
Coordinates | 1011036..1011284 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKC48_RS04705 (OKC48_04705) | 1006254..1007837 | - | 1584 | WP_265222626.1 | DUF5691 domain-containing protein | - |
OKC48_RS04710 (OKC48_04710) | 1007837..1009204 | - | 1368 | WP_265222625.1 | SWIM zinc finger family protein | - |
OKC48_RS04715 (OKC48_04715) | 1009400..1010902 | - | 1503 | WP_265245067.1 | glucose-6-phosphate dehydrogenase | - |
OKC48_RS04720 (OKC48_04720) | 1011036..1011284 | + | 249 | WP_265222623.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
OKC48_RS04725 (OKC48_04725) | 1011281..1011571 | + | 291 | WP_265245068.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OKC48_RS04730 (OKC48_04730) | 1011629..1012291 | + | 663 | WP_265222621.1 | uracil-DNA glycosylase family protein | - |
OKC48_RS04735 (OKC48_04735) | 1012299..1013825 | - | 1527 | WP_265245069.1 | alginate export family protein | - |
OKC48_RS04740 (OKC48_04740) | 1014150..1014848 | + | 699 | WP_265222618.1 | orotidine-5'-phosphate decarboxylase | - |
OKC48_RS04745 (OKC48_04745) | 1014851..1015195 | + | 345 | WP_003605408.1 | DUF1330 domain-containing protein | - |
OKC48_RS04750 (OKC48_04750) | 1015213..1015836 | - | 624 | WP_265222617.1 | TetR/AcrR family transcriptional regulator | - |
OKC48_RS04755 (OKC48_04755) | 1016059..1016259 | - | 201 | WP_003605412.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11054.59 Da Isoelectric Point: 10.8582
>T263179 WP_265245068.1 NZ_CP110130:1011281-1011571 [Methylorubrum extorquens]
MSVRLSPRARGDLSRIWDDSAERWGADQADRYIRLRAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
MSVRLSPRARGDLSRIWDDSAERWGADQADRYIRLRAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|