Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 5112532..5113136 | Replicon | chromosome |
Accession | NZ_CP110128 | ||
Organism | Pseudomonas sp. WJP1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OH720_RS23045 | Protein ID | WP_272603024.1 |
Coordinates | 5112532..5112825 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OH720_RS23050 | Protein ID | WP_272603025.1 |
Coordinates | 5112828..5113136 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH720_RS23030 (OH720_23035) | 5108173..5108481 | + | 309 | WP_008056246.1 | DUF485 domain-containing protein | - |
OH720_RS23035 (OH720_23040) | 5108478..5110124 | + | 1647 | WP_272603022.1 | cation acetate symporter | - |
OH720_RS23040 (OH720_23045) | 5110186..5112240 | + | 2055 | WP_272603023.1 | phenylacetic acid degradation bifunctional protein PaaZ | - |
OH720_RS23045 (OH720_23050) | 5112532..5112825 | + | 294 | WP_272603024.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH720_RS23050 (OH720_23055) | 5112828..5113136 | + | 309 | WP_272603025.1 | putative addiction module antidote protein | Antitoxin |
OH720_RS23055 (OH720_23060) | 5113646..5113960 | + | 315 | WP_272603026.1 | hypothetical protein | - |
OH720_RS23060 (OH720_23065) | 5114105..5114956 | - | 852 | WP_272603027.1 | helix-turn-helix transcriptional regulator | - |
OH720_RS23065 (OH720_23070) | 5115010..5116428 | - | 1419 | WP_272603028.1 | aminotransferase | - |
OH720_RS23070 (OH720_23075) | 5116468..5117574 | - | 1107 | WP_272603029.1 | polyamine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10721.52 Da Isoelectric Point: 10.7649
>T263176 WP_272603024.1 NZ_CP110128:5112532-5112825 [Pseudomonas sp. WJP1]
MNYLVQQTAIFSAWHTSIRDLRARIAIARRIERACAGNLGDIKPVGDGVSEMRVDVGAGYRIYFTMRKTVVIVLLAGGDK
SSQNADIKRAKKLAKEV
MNYLVQQTAIFSAWHTSIRDLRARIAIARRIERACAGNLGDIKPVGDGVSEMRVDVGAGYRIYFTMRKTVVIVLLAGGDK
SSQNADIKRAKKLAKEV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|