Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 3767906..3768498 | Replicon | chromosome |
Accession | NZ_CP110128 | ||
Organism | Pseudomonas sp. WJP1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OH720_RS16840 | Protein ID | WP_272602095.1 |
Coordinates | 3768199..3768498 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OH720_RS16835 | Protein ID | WP_272602094.1 |
Coordinates | 3767906..3768202 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH720_RS16805 (OH720_16810) | 3762917..3763501 | + | 585 | WP_272602088.1 | hypothetical protein | - |
OH720_RS16810 (OH720_16815) | 3763574..3764656 | - | 1083 | WP_272602089.1 | AI-2E family transporter | - |
OH720_RS16815 (OH720_16820) | 3765013..3765450 | + | 438 | WP_272602090.1 | hypothetical protein | - |
OH720_RS16820 (OH720_16825) | 3765754..3766581 | - | 828 | WP_272602091.1 | DUF3618 domain-containing protein | - |
OH720_RS16825 (OH720_16830) | 3766578..3767009 | - | 432 | WP_272602092.1 | phage holin family protein | - |
OH720_RS16830 (OH720_16835) | 3767009..3767659 | - | 651 | WP_272602093.1 | hypothetical protein | - |
OH720_RS16835 (OH720_16840) | 3767906..3768202 | - | 297 | WP_272602094.1 | putative addiction module antidote protein | Antitoxin |
OH720_RS16840 (OH720_16845) | 3768199..3768498 | - | 300 | WP_272602095.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH720_RS16845 (OH720_16850) | 3768660..3769262 | - | 603 | WP_272602096.1 | hypothetical protein | - |
OH720_RS16850 (OH720_16855) | 3769403..3770359 | - | 957 | WP_272602097.1 | threonine dehydratase | - |
OH720_RS16855 (OH720_16860) | 3770465..3771271 | + | 807 | WP_272602098.1 | AraC family transcriptional regulator | - |
OH720_RS16860 (OH720_16865) | 3771268..3771963 | - | 696 | WP_272602099.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
OH720_RS16865 (OH720_16870) | 3772167..3772463 | + | 297 | WP_272602100.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11148.78 Da Isoelectric Point: 10.0625
>T263175 WP_272602095.1 NZ_CP110128:c3768498-3768199 [Pseudomonas sp. WJP1]
MKTIKQTATYMTWERKLKDQRAKAAIAARIFRLANGLLGDVSPVGQGVSELRIHYGPGYRVYFQQRGDEFVLLLCGGDKS
SQSRDIEAAKILASEWRSE
MKTIKQTATYMTWERKLKDQRAKAAIAARIFRLANGLLGDVSPVGQGVSELRIHYGPGYRVYFQQRGDEFVLLLCGGDKS
SQSRDIEAAKILASEWRSE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|