Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1781509..1782125 | Replicon | chromosome |
| Accession | NZ_CP110128 | ||
| Organism | Pseudomonas sp. WJP1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OH720_RS08140 | Protein ID | WP_180202808.1 |
| Coordinates | 1781509..1781721 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | J3IGQ5 |
| Locus tag | OH720_RS08145 | Protein ID | WP_008061213.1 |
| Coordinates | 1781721..1782125 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH720_RS08115 (OH720_08120) | 1777918..1778454 | + | 537 | WP_008055373.1 | DsbE family thiol:disulfide interchange protein | - |
| OH720_RS08120 (OH720_08125) | 1778451..1778921 | + | 471 | WP_008055374.1 | cytochrome c-type biogenesis protein CcmH | - |
| OH720_RS08125 (OH720_08130) | 1778918..1780120 | + | 1203 | WP_272605180.1 | c-type cytochrome biogenesis protein CcmI | - |
| OH720_RS08130 (OH720_08135) | 1780133..1780540 | + | 408 | WP_272605181.1 | hypothetical protein | - |
| OH720_RS08135 (OH720_08140) | 1780803..1781369 | + | 567 | WP_272606417.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
| OH720_RS08140 (OH720_08145) | 1781509..1781721 | + | 213 | WP_180202808.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OH720_RS08145 (OH720_08150) | 1781721..1782125 | + | 405 | WP_008061213.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OH720_RS08150 (OH720_08155) | 1782173..1783378 | - | 1206 | WP_272605182.1 | MFS transporter | - |
| OH720_RS08155 (OH720_08160) | 1783591..1784034 | + | 444 | WP_272605183.1 | hypothetical protein | - |
| OH720_RS08160 (OH720_08165) | 1784159..1785154 | - | 996 | WP_272605184.1 | sulfate ABC transporter substrate-binding protein | - |
| OH720_RS08165 (OH720_08170) | 1785259..1786083 | - | 825 | WP_272605185.1 | ion transporter | - |
| OH720_RS08170 (OH720_08175) | 1786105..1787019 | - | 915 | WP_272605186.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7880.13 Da Isoelectric Point: 10.1896
>T263173 WP_180202808.1 NZ_CP110128:1781509-1781721 [Pseudomonas sp. WJP1]
VQSRLLIKELMEAGWALDRVTGSHHIFTHRYNPYTIPVPHPKKDLPVGTVKSIRRRAGLYCPPASYAGDP
VQSRLLIKELMEAGWALDRVTGSHHIFTHRYNPYTIPVPHPKKDLPVGTVKSIRRRAGLYCPPASYAGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14806.78 Da Isoelectric Point: 4.3062
>AT263173 WP_008061213.1 NZ_CP110128:1781721-1782125 [Pseudomonas sp. WJP1]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEIAHIMLQELAADGEPIPMPTSASVHRSNPEFADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRN
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEIAHIMLQELAADGEPIPMPTSASVHRSNPEFADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRN
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|