Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 424473..425062 | Replicon | chromosome |
Accession | NZ_CP110128 | ||
Organism | Pseudomonas sp. WJP1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OH720_RS01925 | Protein ID | WP_272604350.1 |
Coordinates | 424473..424778 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OH720_RS01930 | Protein ID | WP_007943750.1 |
Coordinates | 424775..425062 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH720_RS01900 (OH720_01900) | 419699..420529 | + | 831 | WP_272604345.1 | type II secretion system protein GspK | - |
OH720_RS01905 (OH720_01905) | 420526..421632 | + | 1107 | WP_272604346.1 | type II secretion system protein GspL | - |
OH720_RS01910 (OH720_01910) | 421629..422090 | + | 462 | WP_272604347.1 | type II secretion system protein GspM | - |
OH720_RS01915 (OH720_01915) | 422083..423363 | - | 1281 | WP_272604348.1 | MFS transporter | - |
OH720_RS01920 (OH720_01920) | 423483..424385 | + | 903 | WP_272604349.1 | LysR family transcriptional regulator | - |
OH720_RS01925 (OH720_01925) | 424473..424778 | + | 306 | WP_272604350.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH720_RS01930 (OH720_01930) | 424775..425062 | + | 288 | WP_007943750.1 | putative addiction module antidote protein | Antitoxin |
OH720_RS01935 (OH720_01935) | 425209..426435 | - | 1227 | WP_272604351.1 | beta-ketoacyl-ACP synthase | - |
OH720_RS01940 (OH720_01940) | 426435..427163 | - | 729 | WP_008058155.1 | 3-oxoacyl-ACP reductase FabG | - |
OH720_RS01945 (OH720_01945) | 427160..427621 | - | 462 | WP_272604352.1 | hotdog family protein | - |
OH720_RS01950 (OH720_01950) | 427618..428814 | - | 1197 | WP_272604353.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
OH720_RS01955 (OH720_01955) | 428811..429293 | - | 483 | WP_272604354.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11397.05 Da Isoelectric Point: 9.9969
>T263172 WP_272604350.1 NZ_CP110128:424473-424778 [Pseudomonas sp. WJP1]
MTEILRSSTFSGWLLKLADSRARMRIQVRIDRMADGNFGDVKAIGEGLSEARIDYGPGYRVYFMQQGSQLVILLCGGDKS
SQTRDIKQARLIAKSWQEQNP
MTEILRSSTFSGWLLKLADSRARMRIQVRIDRMADGNFGDVKAIGEGLSEARIDYGPGYRVYFMQQGSQLVILLCGGDKS
SQTRDIKQARLIAKSWQEQNP
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|