Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1350095..1350727 | Replicon | chromosome |
Accession | NZ_CP110127 | ||
Organism | Mycolicibacterium fortuitum strain ATCC 35855 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | OMF10_RS06350 | Protein ID | WP_003881879.1 |
Coordinates | 1350278..1350727 (+) | Length | 150 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | K0VFT5 |
Locus tag | OMF10_RS06345 | Protein ID | WP_003881878.1 |
Coordinates | 1350095..1350274 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMF10_RS06330 (OMF10_06340) | 1345634..1346368 | + | 735 | WP_003881875.1 | enoyl-CoA hydratase | - |
OMF10_RS06335 (OMF10_06345) | 1346370..1347476 | + | 1107 | WP_003881876.1 | MBL fold metallo-hydrolase | - |
OMF10_RS06340 (OMF10_06350) | 1347543..1350035 | + | 2493 | WP_038563367.1 | cation-translocating P-type ATPase | - |
OMF10_RS06345 (OMF10_06355) | 1350095..1350274 | + | 180 | WP_003881878.1 | antitoxin | Antitoxin |
OMF10_RS06350 (OMF10_06360) | 1350278..1350727 | + | 450 | WP_003881879.1 | SRPBCC family protein | Toxin |
OMF10_RS06355 (OMF10_06365) | 1350731..1351159 | - | 429 | WP_003881880.1 | hypothetical protein | - |
OMF10_RS06360 (OMF10_06370) | 1351179..1351880 | - | 702 | WP_003881881.1 | hypothetical protein | - |
OMF10_RS06365 (OMF10_06375) | 1351877..1352008 | - | 132 | WP_003881882.1 | hypothetical protein | - |
OMF10_RS06370 (OMF10_06380) | 1352024..1352824 | - | 801 | WP_003881883.1 | CbbQ/NirQ/NorQ/GpvN family protein | - |
OMF10_RS06375 (OMF10_06385) | 1352821..1354350 | - | 1530 | WP_003881884.1 | VWA domain-containing protein | - |
OMF10_RS06380 (OMF10_06390) | 1354502..1355104 | - | 603 | WP_003881886.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 150 a.a. Molecular weight: 16117.67 Da Isoelectric Point: 9.6573
>T263170 WP_003881879.1 NZ_CP110127:1350278-1350727 [Mycolicibacterium fortuitum]
MAKLSVSVEVPLPPEKAWEYASDLSRYDEWLSIHRAWRSKLPETLEKGTVIDSIVEVKGMLNRVKWTLVNYKPPQSLTLN
GDGRGGVKVKLIGKITPAAVDGGDGAKVSFDVHLGGPALFGPIGMVVAAALKGDIQQSLNKFKELYASS
MAKLSVSVEVPLPPEKAWEYASDLSRYDEWLSIHRAWRSKLPETLEKGTVIDSIVEVKGMLNRVKWTLVNYKPPQSLTLN
GDGRGGVKVKLIGKITPAAVDGGDGAKVSFDVHLGGPALFGPIGMVVAAALKGDIQQSLNKFKELYASS
Download Length: 450 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|