Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4918..5654 | Replicon | plasmid pMX581-77k |
Accession | NZ_CP110125 | ||
Organism | Klebsiella michiganensis strain MX581 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OKE89_RS28750 | Protein ID | WP_003026803.1 |
Coordinates | 5172..5654 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OKE89_RS28745 | Protein ID | WP_003026799.1 |
Coordinates | 4918..5184 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKE89_RS28720 (OKE89_28715) | 1..1011 | + | 1011 | WP_000200070.1 | RepB family plasmid replication initiator protein | - |
OKE89_RS28725 (OKE89_28720) | 1709..2449 | - | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
OKE89_RS28730 (OKE89_28725) | 2813..3781 | - | 969 | WP_023307223.1 | IS5-like element IS903B family transposase | - |
OKE89_RS28735 (OKE89_28730) | 4026..4229 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
OKE89_RS28740 (OKE89_28735) | 4243..4473 | + | 231 | WP_023307222.1 | hypothetical protein | - |
OKE89_RS28745 (OKE89_28740) | 4918..5184 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OKE89_RS28750 (OKE89_28745) | 5172..5654 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OKE89_RS28755 (OKE89_28750) | 5855..7258 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
OKE89_RS28760 (OKE89_28755) | 7287..7919 | - | 633 | WP_001567369.1 | hypothetical protein | - |
OKE89_RS28765 (OKE89_28760) | 8149..9492 | + | 1344 | WP_080339306.1 | ISNCY family transposase | - |
OKE89_RS28770 (OKE89_28765) | 9563..10381 | - | 819 | WP_023307220.1 | abortive infection family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..77402 | 77402 | |
- | inside | IScluster/Tn | - | - | 2813..32871 | 30058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T263169 WP_003026803.1 NZ_CP110125:5172-5654 [Klebsiella michiganensis]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |