Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 9775..10297 Replicon plasmid pMX581-tetX
Accession NZ_CP110124
Organism Klebsiella michiganensis strain MX581

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag OKE89_RS28585 Protein ID WP_000220560.1
Coordinates 9775..10056 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag OKE89_RS28590 Protein ID WP_000121743.1
Coordinates 10046..10297 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKE89_RS28545 (OKE89_28540) 5636..6793 - 1158 WP_000538023.1 DNA distortion polypeptide 2 -
OKE89_RS28550 (OKE89_28545) 6796..7341 - 546 WP_038976855.1 DNA distortion polypeptide 1 -
OKE89_RS28555 (OKE89_28550) 7668..7940 - 273 WP_000160399.1 hypothetical protein -
OKE89_RS28560 (OKE89_28555) 7953..8102 - 150 WP_000003880.1 hypothetical protein -
OKE89_RS28565 (OKE89_28560) 8389..8718 - 330 WP_000866648.1 hypothetical protein -
OKE89_RS28570 (OKE89_28565) 8811..9026 - 216 WP_001180116.1 hypothetical protein -
OKE89_RS28575 (OKE89_28570) 9016..9261 - 246 WP_000356546.1 hypothetical protein -
OKE89_RS28580 (OKE89_28575) 9306..9629 - 324 WP_001181903.1 hypothetical protein -
OKE89_RS28585 (OKE89_28580) 9775..10056 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OKE89_RS28590 (OKE89_28585) 10046..10297 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
OKE89_RS28595 (OKE89_28590) 11553..12389 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
OKE89_RS28600 (OKE89_28595) 12429..12875 + 447 WP_001074386.1 hypothetical protein -
OKE89_RS28605 (OKE89_28600) 13012..13365 + 354 WP_000876434.1 DNA distortion polypeptide 3 -
OKE89_RS28610 (OKE89_28605) 13425..14393 - 969 WP_166501310.1 IS5-like element IS903B family transposase -
OKE89_RS28615 (OKE89_28610) 14395..14688 - 294 WP_015060510.1 hypothetical protein -
OKE89_RS28620 (OKE89_28615) 14704..14934 - 231 WP_000051064.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / tet(X4) / floR / tet(A) - 1..31314 31314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T263168 WP_000220560.1 NZ_CP110124:c10056-9775 [Klebsiella michiganensis]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT263168 WP_000121743.1 NZ_CP110124:c10297-10046 [Klebsiella michiganensis]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References