Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 9775..10297 | Replicon | plasmid pMX581-tetX |
| Accession | NZ_CP110124 | ||
| Organism | Klebsiella michiganensis strain MX581 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G3CAN5 |
| Locus tag | OKE89_RS28585 | Protein ID | WP_000220560.1 |
| Coordinates | 9775..10056 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | OKE89_RS28590 | Protein ID | WP_000121743.1 |
| Coordinates | 10046..10297 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKE89_RS28545 (OKE89_28540) | 5636..6793 | - | 1158 | WP_000538023.1 | DNA distortion polypeptide 2 | - |
| OKE89_RS28550 (OKE89_28545) | 6796..7341 | - | 546 | WP_038976855.1 | DNA distortion polypeptide 1 | - |
| OKE89_RS28555 (OKE89_28550) | 7668..7940 | - | 273 | WP_000160399.1 | hypothetical protein | - |
| OKE89_RS28560 (OKE89_28555) | 7953..8102 | - | 150 | WP_000003880.1 | hypothetical protein | - |
| OKE89_RS28565 (OKE89_28560) | 8389..8718 | - | 330 | WP_000866648.1 | hypothetical protein | - |
| OKE89_RS28570 (OKE89_28565) | 8811..9026 | - | 216 | WP_001180116.1 | hypothetical protein | - |
| OKE89_RS28575 (OKE89_28570) | 9016..9261 | - | 246 | WP_000356546.1 | hypothetical protein | - |
| OKE89_RS28580 (OKE89_28575) | 9306..9629 | - | 324 | WP_001181903.1 | hypothetical protein | - |
| OKE89_RS28585 (OKE89_28580) | 9775..10056 | - | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OKE89_RS28590 (OKE89_28585) | 10046..10297 | - | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| OKE89_RS28595 (OKE89_28590) | 11553..12389 | + | 837 | WP_001050931.1 | RepB family plasmid replication initiator protein | - |
| OKE89_RS28600 (OKE89_28595) | 12429..12875 | + | 447 | WP_001074386.1 | hypothetical protein | - |
| OKE89_RS28605 (OKE89_28600) | 13012..13365 | + | 354 | WP_000876434.1 | DNA distortion polypeptide 3 | - |
| OKE89_RS28610 (OKE89_28605) | 13425..14393 | - | 969 | WP_166501310.1 | IS5-like element IS903B family transposase | - |
| OKE89_RS28615 (OKE89_28610) | 14395..14688 | - | 294 | WP_015060510.1 | hypothetical protein | - |
| OKE89_RS28620 (OKE89_28615) | 14704..14934 | - | 231 | WP_000051064.1 | plasmid partition protein ParG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / tet(X4) / floR / tet(A) | - | 1..31314 | 31314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T263168 WP_000220560.1 NZ_CP110124:c10056-9775 [Klebsiella michiganensis]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G3CAN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |