Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4499773..4500392 | Replicon | chromosome |
| Accession | NZ_CP110123 | ||
| Organism | Klebsiella michiganensis strain MX581 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | J5X5R4 |
| Locus tag | OKE89_RS21860 | Protein ID | WP_004848333.1 |
| Coordinates | 4500174..4500392 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7H5A3P3 |
| Locus tag | OKE89_RS21855 | Protein ID | WP_004848337.1 |
| Coordinates | 4499773..4500147 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKE89_RS21845 (OKE89_21840) | 4494932..4496125 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OKE89_RS21850 (OKE89_21845) | 4496148..4499294 | + | 3147 | WP_004848339.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OKE89_RS21855 (OKE89_21850) | 4499773..4500147 | + | 375 | WP_004848337.1 | Hha toxicity modulator TomB | Antitoxin |
| OKE89_RS21860 (OKE89_21855) | 4500174..4500392 | + | 219 | WP_004848333.1 | HHA domain-containing protein | Toxin |
| OKE89_RS21865 (OKE89_21860) | 4500554..4501120 | + | 567 | WP_004848331.1 | maltose O-acetyltransferase | - |
| OKE89_RS21870 (OKE89_21865) | 4501092..4501226 | - | 135 | WP_223226670.1 | hypothetical protein | - |
| OKE89_RS21875 (OKE89_21870) | 4501247..4501717 | + | 471 | WP_004848329.1 | YlaC family protein | - |
| OKE89_RS21880 (OKE89_21875) | 4501692..4503146 | - | 1455 | WP_004848326.1 | PLP-dependent aminotransferase family protein | - |
| OKE89_RS21885 (OKE89_21880) | 4503248..4503946 | + | 699 | WP_004848324.1 | GNAT family protein | - |
| OKE89_RS21890 (OKE89_21885) | 4503943..4504083 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OKE89_RS21895 (OKE89_21890) | 4504083..4504346 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8626.03 Da Isoelectric Point: 8.9008
>T263166 WP_004848333.1 NZ_CP110123:4500174-4500392 [Klebsiella michiganensis]
MSDKTLTKVDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKVDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14394.10 Da Isoelectric Point: 4.7295
>AT263166 WP_004848337.1 NZ_CP110123:4499773-4500147 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSADNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSADNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R4L0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H5A3P3 |