Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4499773..4500392 Replicon chromosome
Accession NZ_CP110123
Organism Klebsiella michiganensis strain MX581

Toxin (Protein)


Gene name Hha Uniprot ID J5X5R4
Locus tag OKE89_RS21860 Protein ID WP_004848333.1
Coordinates 4500174..4500392 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A7H5A3P3
Locus tag OKE89_RS21855 Protein ID WP_004848337.1
Coordinates 4499773..4500147 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKE89_RS21845 (OKE89_21840) 4494932..4496125 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OKE89_RS21850 (OKE89_21845) 4496148..4499294 + 3147 WP_004848339.1 multidrug efflux RND transporter permease subunit AcrB -
OKE89_RS21855 (OKE89_21850) 4499773..4500147 + 375 WP_004848337.1 Hha toxicity modulator TomB Antitoxin
OKE89_RS21860 (OKE89_21855) 4500174..4500392 + 219 WP_004848333.1 HHA domain-containing protein Toxin
OKE89_RS21865 (OKE89_21860) 4500554..4501120 + 567 WP_004848331.1 maltose O-acetyltransferase -
OKE89_RS21870 (OKE89_21865) 4501092..4501226 - 135 WP_223226670.1 hypothetical protein -
OKE89_RS21875 (OKE89_21870) 4501247..4501717 + 471 WP_004848329.1 YlaC family protein -
OKE89_RS21880 (OKE89_21875) 4501692..4503146 - 1455 WP_004848326.1 PLP-dependent aminotransferase family protein -
OKE89_RS21885 (OKE89_21880) 4503248..4503946 + 699 WP_004848324.1 GNAT family protein -
OKE89_RS21890 (OKE89_21885) 4503943..4504083 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
OKE89_RS21895 (OKE89_21890) 4504083..4504346 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8626.03 Da        Isoelectric Point: 8.9008

>T263166 WP_004848333.1 NZ_CP110123:4500174-4500392 [Klebsiella michiganensis]
MSDKTLTKVDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14394.10 Da        Isoelectric Point: 4.7295

>AT263166 WP_004848337.1 NZ_CP110123:4499773-4500147 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSADNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4R4L0

Antitoxin

Source ID Structure
AlphaFold DB A0A7H5A3P3

References