Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2068682..2069272 | Replicon | chromosome |
Accession | NZ_CP110123 | ||
Organism | Klebsiella michiganensis strain MX581 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A7H5AAK0 |
Locus tag | OKE89_RS09945 | Protein ID | WP_004852304.1 |
Coordinates | 2068940..2069272 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | J6I3K7 |
Locus tag | OKE89_RS09940 | Protein ID | WP_004852307.1 |
Coordinates | 2068682..2068939 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKE89_RS09920 (OKE89_09920) | 2064580..2065185 | - | 606 | WP_049106037.1 | glutathione S-transferase family protein | - |
OKE89_RS09925 (OKE89_09925) | 2065365..2066276 | + | 912 | WP_049106038.1 | LysR substrate-binding domain-containing protein | - |
OKE89_RS09930 (OKE89_09930) | 2066329..2067327 | - | 999 | WP_264607073.1 | aldo/keto reductase | - |
OKE89_RS09935 (OKE89_09935) | 2067428..2068342 | + | 915 | WP_004852309.1 | LysR family transcriptional regulator | - |
OKE89_RS09940 (OKE89_09940) | 2068682..2068939 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
OKE89_RS09945 (OKE89_09945) | 2068940..2069272 | + | 333 | WP_004852304.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OKE89_RS09950 (OKE89_09950) | 2069591..2070952 | - | 1362 | WP_003036316.1 | HEPN/Toprim-associated domain-containing protein | - |
OKE89_RS09955 (OKE89_09955) | 2071788..2072726 | + | 939 | WP_003036321.1 | hypothetical protein | - |
OKE89_RS09960 (OKE89_09960) | 2072802..2073284 | + | 483 | WP_003036324.1 | hypothetical protein | - |
OKE89_RS09965 (OKE89_09965) | 2073306..2074109 | + | 804 | WP_003036327.1 | TIGR02391 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11863.81 Da Isoelectric Point: 10.5834
>T263161 WP_004852304.1 NZ_CP110123:2068940-2069272 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGIKTLGVIRCDQPRTI
DMTARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGIKTLGVIRCDQPRTI
DMTARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H5AAK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3HDW8 |