Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1462480..1463114 | Replicon | chromosome |
Accession | NZ_CP110123 | ||
Organism | Klebsiella michiganensis strain MX581 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7H5A909 |
Locus tag | OKE89_RS07110 | Protein ID | WP_004853162.1 |
Coordinates | 1462710..1463114 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2J4P7G5 |
Locus tag | OKE89_RS07105 | Protein ID | WP_004853165.1 |
Coordinates | 1462480..1462710 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKE89_RS07090 (OKE89_07090) | 1457594..1458847 | + | 1254 | WP_004853170.1 | site-specific integrase | - |
OKE89_RS07095 (OKE89_07095) | 1458900..1460558 | + | 1659 | WP_264605001.1 | hypothetical protein | - |
OKE89_RS07100 (OKE89_07100) | 1460624..1461499 | - | 876 | WP_004853166.1 | integrase domain-containing protein | - |
OKE89_RS07105 (OKE89_07105) | 1462480..1462710 | + | 231 | WP_004853165.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OKE89_RS07110 (OKE89_07110) | 1462710..1463114 | + | 405 | WP_004853162.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
OKE89_RS07115 (OKE89_07115) | 1463219..1464232 | - | 1014 | WP_004853161.1 | Gfo/Idh/MocA family oxidoreductase | - |
OKE89_RS07120 (OKE89_07120) | 1464243..1465223 | - | 981 | WP_004853159.1 | PTS glucitol/sorbitol transporter subunit IIB | - |
OKE89_RS07125 (OKE89_07125) | 1465220..1465594 | - | 375 | WP_004853156.1 | PTS glucitol/sorbitol transporter subunit IIA | - |
OKE89_RS07130 (OKE89_07130) | 1465591..1466112 | - | 522 | WP_004853154.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
OKE89_RS07135 (OKE89_07135) | 1466476..1466949 | + | 474 | WP_032721562.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1449418..1478822 | 29404 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15005.36 Da Isoelectric Point: 7.8441
>T263160 WP_004853162.1 NZ_CP110123:1462710-1463114 [Klebsiella michiganensis]
MLKYMLDTNICIYTIKNKPQAVREAFNQHYGRMCISSVTLMELIYGAEKSASPEKNLRVVEGFIARLEVLNYGIDVAVQT
GQIRAELARAGTPVGPYDSMIAAHARALGLILVTNNTREFERINGLRLEDWSIS
MLKYMLDTNICIYTIKNKPQAVREAFNQHYGRMCISSVTLMELIYGAEKSASPEKNLRVVEGFIARLEVLNYGIDVAVQT
GQIRAELARAGTPVGPYDSMIAAHARALGLILVTNNTREFERINGLRLEDWSIS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H5A909 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4P7G5 |