Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 874652..875309 | Replicon | chromosome |
| Accession | NZ_CP110123 | ||
| Organism | Klebsiella michiganensis strain MX581 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | OKE89_RS04255 | Protein ID | WP_004854060.1 |
| Coordinates | 874899..875309 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | OKE89_RS04250 | Protein ID | WP_004124953.1 |
| Coordinates | 874652..874918 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKE89_RS04235 (OKE89_04235) | 869904..870329 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| OKE89_RS04240 (OKE89_04240) | 870450..873248 | - | 2799 | WP_264604054.1 | transcriptional regulator DagR | - |
| OKE89_RS04245 (OKE89_04245) | 873424..874407 | - | 984 | WP_004854063.1 | tRNA-modifying protein YgfZ | - |
| OKE89_RS04250 (OKE89_04250) | 874652..874918 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| OKE89_RS04255 (OKE89_04255) | 874899..875309 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| OKE89_RS04260 (OKE89_04260) | 875318..875839 | - | 522 | WP_004854059.1 | flavodoxin FldB | - |
| OKE89_RS04265 (OKE89_04265) | 875961..876857 | + | 897 | WP_004854056.1 | site-specific tyrosine recombinase XerD | - |
| OKE89_RS04270 (OKE89_04270) | 876880..877593 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OKE89_RS04275 (OKE89_04275) | 877599..879332 | + | 1734 | WP_004854053.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T263159 WP_004854060.1 NZ_CP110123:874899-875309 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |