Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 21373..21838 Replicon plasmid p2-331_3
Accession NZ_CP110120
Organism Escherichia coli strain 2-331

Toxin (Protein)


Gene name TsxA Uniprot ID A0A5Y6UAV0
Locus tag OMD12_RS25525 Protein ID WP_001230708.1
Coordinates 21373..21624 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag OMD12_RS25530 Protein ID WP_000801440.1
Coordinates 21611..21838 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD12_RS25505 (OMD12_25320) 18893..19228 + 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -
OMD12_RS25510 (OMD12_25325) 19225..19575 + 351 WP_000127483.1 hypothetical protein -
OMD12_RS25515 (OMD12_25330) 20214..20729 + 516 WP_001025396.1 J domain-containing protein -
OMD12_RS25520 (OMD12_25335) 20834..21376 + 543 WP_001083908.1 hypothetical protein -
OMD12_RS25525 (OMD12_25340) 21373..21624 + 252 WP_001230708.1 hypothetical protein Toxin
OMD12_RS25530 (OMD12_25345) 21611..21838 + 228 WP_000801440.1 hypothetical protein Antitoxin
OMD12_RS25535 (OMD12_25350) 22230..22529 + 300 WP_000650313.1 hypothetical protein -
OMD12_RS25540 (OMD12_25355) 22621..22986 + 366 WP_000854262.1 hypothetical protein -
OMD12_RS25545 (OMD12_25360) 23261..23434 + 174 WP_071821486.1 type II toxin-antitoxin system HicB family antitoxin -
OMD12_RS25550 (OMD12_25365) 23797..24300 + 504 WP_000781818.1 DNA distortion polypeptide 1 -
OMD12_RS25555 (OMD12_25370) 24304..25533 + 1230 WP_000539545.1 DNA relaxase/nickase TaxC -
OMD12_RS25560 (OMD12_25375) 25610..25903 + 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
OMD12_RS25565 (OMD12_25380) 25900..26115 + 216 WP_000760375.1 EexN family lipoprotein -
OMD12_RS25570 (OMD12_25385) 26292..26468 + 177 WP_000660496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..33826 33826


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9750.19 Da        Isoelectric Point: 9.8104

>T263158 WP_001230708.1 NZ_CP110120:21373-21624 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLRKDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT263158 WP_000801440.1 NZ_CP110120:21611-21838 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y6UAV0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References