Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 135117..135642 | Replicon | plasmid p2-331_1 |
| Accession | NZ_CP110118 | ||
| Organism | Escherichia coli strain 2-331 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | OMD12_RS24935 | Protein ID | WP_001159868.1 |
| Coordinates | 135117..135422 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | OMD12_RS24940 | Protein ID | WP_000813634.1 |
| Coordinates | 135424..135642 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD12_RS24920 (131027) | 131027..132193 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| OMD12_RS24925 (132781) | 132781..133536 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| OMD12_RS24930 (134310) | 134310..135116 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| OMD12_RS24935 (135117) | 135117..135422 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OMD12_RS24940 (135424) | 135424..135642 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OMD12_RS24945 (136276) | 136276..136473 | + | 198 | WP_000215657.1 | hypothetical protein | - |
| OMD12_RS24950 (136470) | 136470..136754 | - | 285 | WP_000642771.1 | hypothetical protein | - |
| OMD12_RS24955 (136774) | 136774..137907 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / blaTEM-1B / rmtB / blaNDM-6 / sul1 / qacE / aadA2 / dfrA12 / tet(A) | - | 1..143596 | 143596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T263153 WP_001159868.1 NZ_CP110118:c135422-135117 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|