Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 78063..78688 | Replicon | plasmid p2-331_1 |
Accession | NZ_CP110118 | ||
Organism | Escherichia coli strain 2-331 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1D7QA53 |
Locus tag | OMD12_RS24605 | Protein ID | WP_039023147.1 |
Coordinates | 78290..78688 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D7QA08 |
Locus tag | OMD12_RS24600 | Protein ID | WP_039023146.1 |
Coordinates | 78063..78290 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD12_RS24600 (78063) | 78063..78290 | + | 228 | WP_039023146.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
OMD12_RS24605 (78290) | 78290..78688 | + | 399 | WP_039023147.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OMD12_RS24610 (78697) | 78697..80895 | - | 2199 | WP_061856952.1 | type IV conjugative transfer system coupling protein TraD | - |
OMD12_RS24615 (81148) | 81148..81879 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
OMD12_RS24620 (81911) | 81911..82408 | - | 498 | WP_000605862.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / blaTEM-1B / rmtB / blaNDM-6 / sul1 / qacE / aadA2 / dfrA12 / tet(A) | - | 1..143596 | 143596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14885.26 Da Isoelectric Point: 8.2824
>T263149 WP_039023147.1 NZ_CP110118:78290-78688 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA53 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA08 |