Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5213..5772 Replicon plasmid p2-331_1
Accession NZ_CP110118
Organism Escherichia coli strain 2-331

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag OMD12_RS24180 Protein ID WP_000421272.1
Coordinates 5213..5488 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag OMD12_RS24185 Protein ID WP_001387467.1
Coordinates 5488..5772 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD12_RS24145 (1263) 1263..2003 - 741 WP_001066942.1 tyrosine-type recombinase/integrase -
OMD12_RS24150 (2124) 2124..2306 - 183 WP_042065278.1 hypothetical protein -
OMD12_RS24155 (2373) 2373..2662 - 290 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
OMD12_RS24160 (2649) 2649..2917 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
OMD12_RS24165 (3449) 3449..4618 + 1170 WP_001072355.1 hypothetical protein -
OMD12_RS24170 (4651) 4651..4779 + 129 Protein_6 IS481 family transposase -
OMD12_RS24175 (4904) 4904..5107 - 204 Protein_7 hypothetical protein -
OMD12_RS24180 (5213) 5213..5488 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OMD12_RS24185 (5488) 5488..5772 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
OMD12_RS24190 (6377) 6377..7129 + 753 WP_000562172.1 IclR family transcriptional regulator -
OMD12_RS24195 (7175) 7175..8140 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
OMD12_RS24200 (8173) 8173..8553 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
OMD12_RS24205 (8578) 8578..9207 - 630 WP_231528705.1 dihydrodipicolinate synthase family protein -
OMD12_RS24210 (9251) 9251..9883 + 633 Protein_14 sugar ABC transporter permease -
OMD12_RS24215 (9873) 9873..10760 + 888 WP_001271561.1 carbohydrate ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / blaTEM-1B / rmtB / blaNDM-6 / sul1 / qacE / aadA2 / dfrA12 / tet(A) - 1..143596 143596


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T263147 WP_000421272.1 NZ_CP110118:c5488-5213 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT263147 WP_001387467.1 NZ_CP110118:c5772-5488 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References