Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3641632..3642250 | Replicon | chromosome |
Accession | NZ_CP110117 | ||
Organism | Escherichia coli strain 2-331 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OMD12_RS17855 | Protein ID | WP_001291435.1 |
Coordinates | 3642032..3642250 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | OMD12_RS17850 | Protein ID | WP_000344800.1 |
Coordinates | 3641632..3642006 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD12_RS17840 (3636721) | 3636721..3637914 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OMD12_RS17845 (3637937) | 3637937..3641086 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
OMD12_RS17850 (3641632) | 3641632..3642006 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
OMD12_RS17855 (3642032) | 3642032..3642250 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OMD12_RS17860 (3642422) | 3642422..3642973 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OMD12_RS17865 (3643089) | 3643089..3643559 | + | 471 | WP_000136192.1 | YlaC family protein | - |
OMD12_RS17870 (3643723) | 3643723..3645273 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OMD12_RS17875 (3645315) | 3645315..3645668 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OMD12_RS17885 (3646047) | 3646047..3646358 | + | 312 | WP_000409911.1 | MGMT family protein | - |
OMD12_RS17890 (3646389) | 3646389..3646961 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263141 WP_001291435.1 NZ_CP110117:3642032-3642250 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT263141 WP_000344800.1 NZ_CP110117:3641632-3642006 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |