Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1928346..1929181 | Replicon | chromosome |
Accession | NZ_CP110117 | ||
Organism | Escherichia coli strain 2-331 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
Locus tag | OMD12_RS09320 | Protein ID | WP_000854761.1 |
Coordinates | 1928346..1928723 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | OMD12_RS09325 | Protein ID | WP_001295723.1 |
Coordinates | 1928813..1929181 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD12_RS09295 (1923465) | 1923465..1925004 | + | 1540 | Protein_1820 | IS66-like element ISEc22 family transposase | - |
OMD12_RS09300 (1925526) | 1925526..1927067 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
OMD12_RS09305 (1927082) | 1927082..1927828 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
OMD12_RS09310 (1928021) | 1928021..1928101 | - | 81 | Protein_1823 | hypothetical protein | - |
OMD12_RS09315 (1928201) | 1928201..1928349 | - | 149 | Protein_1824 | DUF5983 family protein | - |
OMD12_RS09320 (1928346) | 1928346..1928723 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
OMD12_RS09325 (1928813) | 1928813..1929181 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OMD12_RS09330 (1929344) | 1929344..1929565 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
OMD12_RS09335 (1929628) | 1929628..1930104 | - | 477 | WP_001186711.1 | RadC family protein | - |
OMD12_RS09340 (1930119) | 1930119..1930592 | - | 474 | WP_000855059.1 | antirestriction protein | - |
OMD12_RS09345 (1930934) | 1930934..1931752 | - | 819 | WP_001234729.1 | DUF932 domain-containing protein | - |
OMD12_RS09350 (1931870) | 1931870..1932065 | - | 196 | Protein_1831 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T263134 WP_000854761.1 NZ_CP110117:c1928723-1928346 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT263134 WP_001295723.1 NZ_CP110117:c1929181-1928813 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X9TM58 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |