Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 796701..797533 Replicon chromosome
Accession NZ_CP110117
Organism Escherichia coli strain 2-331

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag OMD12_RS03895 Protein ID WP_000854765.1
Coordinates 796701..797075 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag OMD12_RS03900 Protein ID WP_001295723.1
Coordinates 797165..797533 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD12_RS03860 (791779) 791779..792378 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
OMD12_RS03865 (792381) 792381..793358 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
OMD12_RS03870 (793355) 793355..794533 + 1179 WP_000094991.1 type II secretion system protein GspL -
OMD12_RS03875 (794535) 794535..795071 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
OMD12_RS03880 (795352) 795352..796194 - 843 WP_022645115.1 DUF4942 domain-containing protein -
OMD12_RS03885 (796279) 796279..796473 - 195 WP_024181941.1 DUF957 domain-containing protein -
OMD12_RS03890 (796498) 796498..796701 - 204 WP_001398797.1 DUF5983 family protein -
OMD12_RS03895 (796701) 796701..797075 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
OMD12_RS03900 (797165) 797165..797533 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OMD12_RS03905 (797696) 797696..797917 - 222 WP_000692341.1 DUF987 domain-containing protein -
OMD12_RS03910 (797980) 797980..798456 - 477 WP_001186774.1 RadC family protein -
OMD12_RS03915 (798472) 798472..798951 - 480 WP_057109541.1 antirestriction protein -
OMD12_RS03920 (799051) 799051..799191 + 141 WP_000997937.1 hypothetical protein -
OMD12_RS03925 (799217) 799217..800035 - 819 WP_001175165.1 DUF932 domain-containing protein -
OMD12_RS03930 (800125) 800125..800358 - 234 WP_001278293.1 DUF905 family protein -
OMD12_RS03935 (800364) 800364..801041 - 678 WP_001097302.1 hypothetical protein -
OMD12_RS03940 (801189) 801189..801869 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T263130 WP_000854765.1 NZ_CP110117:c797075-796701 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT263130 WP_001295723.1 NZ_CP110117:c797533-797165 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References