Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 46837..47402 | Replicon | plasmid pYA7-1a |
Accession | NZ_CP110115 | ||
Organism | Arthrobacter sp. YA7-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OIT41_RS20035 | Protein ID | WP_264638080.1 |
Coordinates | 47109..47402 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OIT41_RS20030 | Protein ID | WP_241710795.1 |
Coordinates | 46837..47112 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIT41_RS20010 (OIT41_20010) | 43008..44141 | + | 1134 | WP_264636462.1 | site-specific integrase | - |
OIT41_RS20015 (OIT41_20015) | 44134..44487 | + | 354 | WP_264636463.1 | helix-turn-helix transcriptional regulator | - |
OIT41_RS20020 (OIT41_20020) | 44480..45946 | + | 1467 | WP_264638079.1 | Fis family transcriptional regulator | - |
OIT41_RS20025 (OIT41_20025) | 46087..46734 | + | 648 | WP_264636465.1 | hypothetical protein | - |
OIT41_RS20030 (OIT41_20030) | 46837..47112 | + | 276 | WP_241710795.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OIT41_RS20035 (OIT41_20035) | 47109..47402 | + | 294 | WP_264638080.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIT41_RS20040 (OIT41_20040) | 48429..49655 | - | 1227 | WP_241710794.1 | ATP-binding protein | - |
OIT41_RS20045 (OIT41_20045) | 49954..50276 | + | 323 | Protein_42 | hypothetical protein | - |
OIT41_RS20050 (OIT41_20050) | 50358..50660 | - | 303 | WP_241710793.1 | DUF4193 domain-containing protein | - |
OIT41_RS20055 (OIT41_20055) | 50904..52136 | - | 1233 | WP_241710792.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..129773 | 129773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10886.48 Da Isoelectric Point: 10.7271
>T263126 WP_264638080.1 NZ_CP110115:47109-47402 [Arthrobacter sp. YA7-1]
VTGAESTGPSPWNVEVTSPALRGFRRLPEKAAAAIVEFVTGALARNPHRLSKPLTNGLLGLRTARRGDYRVLFTLDIEEH
ILYVHRIEHRSDVYKPR
VTGAESTGPSPWNVEVTSPALRGFRRLPEKAAAAIVEFVTGALARNPHRLSKPLTNGLLGLRTARRGDYRVLFTLDIEEH
ILYVHRIEHRSDVYKPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|