Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-StbC |
Location | 1005821..1006488 | Replicon | chromosome |
Accession | NZ_CP110110 | ||
Organism | Stutzerimonas balearica strain Z8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | D3P44_RS04695 | Protein ID | WP_212739827.1 |
Coordinates | 1005821..1006246 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | D3P44_RS04700 | Protein ID | WP_200628058.1 |
Coordinates | 1006243..1006488 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D3P44_RS04665 (D3P44_004665) | 1001038..1001601 | - | 564 | WP_043218847.1 | hypothetical protein | - |
D3P44_RS04670 (D3P44_004670) | 1001751..1002539 | + | 789 | WP_041107591.1 | trehalose-phosphatase | - |
D3P44_RS04675 (D3P44_004675) | 1002536..1003924 | + | 1389 | WP_043218848.1 | alpha,alpha-trehalose-phosphate synthase (UDP-forming) | - |
D3P44_RS04680 (D3P44_004680) | 1004010..1004654 | + | 645 | WP_041107521.1 | carbonate dehydratase | - |
D3P44_RS04685 (D3P44_004685) | 1004678..1005562 | + | 885 | WP_043218850.1 | DMT family transporter | - |
D3P44_RS04695 (D3P44_004695) | 1005821..1006246 | - | 426 | WP_212739827.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
D3P44_RS04700 (D3P44_004700) | 1006243..1006488 | - | 246 | WP_200628058.1 | plasmid stabilization protein | Antitoxin |
D3P44_RS04705 (D3P44_004705) | 1006978..1007307 | + | 330 | WP_212739828.1 | hypothetical protein | - |
D3P44_RS04710 (D3P44_004710) | 1007369..1008007 | + | 639 | WP_212739829.1 | hypothetical protein | - |
D3P44_RS04715 (D3P44_004715) | 1008065..1009369 | + | 1305 | WP_010793081.1 | IS1380-like element ISPa33 family transposase | - |
D3P44_RS04720 (D3P44_004720) | 1009462..1010199 | + | 738 | WP_268845839.1 | hypothetical protein | - |
D3P44_RS04725 (D3P44_004725) | 1010508..1010903 | - | 396 | WP_043218856.1 | MerR family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15091.33 Da Isoelectric Point: 4.4829
>T263123 WP_212739827.1 NZ_CP110110:c1006246-1005821 [Stutzerimonas balearica]
MILLDTNVLSELMRAKPAPQVLEWVDAQPASELAISAITVAEILYGIARMPDGKRKQGLLDIASAMFEEDFAGNILPFDA
DAAVHYAEIAAATEAKGRIVDMADAQIAAIGRLHDAVIATRNARHFEPLGVALVDPWSGRG
MILLDTNVLSELMRAKPAPQVLEWVDAQPASELAISAITVAEILYGIARMPDGKRKQGLLDIASAMFEEDFAGNILPFDA
DAAVHYAEIAAATEAKGRIVDMADAQIAAIGRLHDAVIATRNARHFEPLGVALVDPWSGRG
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|