Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 3720467..3721109 | Replicon | chromosome |
Accession | NZ_CP110109 | ||
Organism | Bacillus thuringiensis strain TG-5 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | OKV75_RS19060 | Protein ID | WP_000635965.1 |
Coordinates | 3720759..3721109 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | OKV75_RS19055 | Protein ID | WP_000004570.1 |
Coordinates | 3720467..3720754 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKV75_RS19030 | 3715784..3716746 | + | 963 | WP_000961144.1 | UV DNA damage repair endonuclease UvsE | - |
OKV75_RS19035 | 3716739..3717311 | - | 573 | WP_000908526.1 | rhomboid family intramembrane serine protease | - |
OKV75_RS19040 | 3717405..3717764 | + | 360 | WP_071713817.1 | holo-ACP synthase | - |
OKV75_RS19045 | 3717921..3718871 | + | 951 | WP_002094231.1 | outer membrane lipoprotein carrier protein LolA | - |
OKV75_RS19050 | 3718989..3720158 | + | 1170 | WP_000390593.1 | alanine racemase | - |
OKV75_RS19055 | 3720467..3720754 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
OKV75_RS19060 | 3720759..3721109 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OKV75_RS19065 | 3721178..3723346 | + | 2169 | WP_071713819.1 | Tex family protein | - |
OKV75_RS19070 | 3723404..3723520 | - | 117 | WP_001143640.1 | cortex morphogenetic protein CmpA | - |
OKV75_RS19075 | 3723716..3724174 | + | 459 | WP_071713820.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T263122 WP_000635965.1 NZ_CP110109:3720759-3721109 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |