Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 463508..464486 | Replicon | chromosome |
Accession | NZ_CP110109 | ||
Organism | Bacillus thuringiensis strain TG-5 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | OKV75_RS02510 | Protein ID | WP_072938428.1 |
Coordinates | 463508..464245 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | W8YZL5 |
Locus tag | OKV75_RS02515 | Protein ID | WP_000237818.1 |
Coordinates | 464358..464486 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKV75_RS02485 | 459123..459530 | + | 408 | WP_000072492.1 | VOC family protein | - |
OKV75_RS02490 | 459543..459932 | + | 390 | Protein_497 | SAM-dependent methyltransferase | - |
OKV75_RS02495 | 460090..461766 | - | 1677 | WP_000745300.1 | alpha-keto acid decarboxylase family protein | - |
OKV75_RS02500 | 461883..462365 | + | 483 | WP_072938422.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OKV75_RS02505 | 462532..463269 | + | 738 | WP_072938425.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
OKV75_RS02510 | 463508..464245 | + | 738 | WP_072938428.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OKV75_RS02515 | 464358..464486 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
OKV75_RS02520 | 464559..464735 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
OKV75_RS02525 | 464755..465144 | - | 390 | WP_098398982.1 | YxeA family protein | - |
OKV75_RS02530 | 465356..466825 | + | 1470 | WP_071714840.1 | beta-Ala-His dipeptidase | - |
OKV75_RS02535 | 467071..467880 | + | 810 | WP_000664543.1 | papain-like cysteine protease family protein | - |
OKV75_RS02540 | 467906..468508 | + | 603 | WP_098919627.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 407835..477710 | 69875 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28364.13 Da Isoelectric Point: 9.0291
>T263121 WP_072938428.1 NZ_CP110109:463508-464245 [Bacillus thuringiensis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPSVFGKMEWHTEEEYTKSLNAFLDSYAEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPSVFGKMEWHTEEEYTKSLNAFLDSYAEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|