Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1379944..1380551 | Replicon | chromosome |
| Accession | NZ_CP110108 | ||
| Organism | Alcaligenes sp. SMD-FA | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OKX01_RS06330 | Protein ID | WP_264672635.1 |
| Coordinates | 1380246..1380551 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OKX01_RS06325 | Protein ID | WP_264672634.1 |
| Coordinates | 1379944..1380249 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKX01_RS06300 (OKX01_06300) | 1375046..1376449 | - | 1404 | WP_264672631.1 | GntP family permease | - |
| OKX01_RS06310 (OKX01_06310) | 1376953..1378173 | + | 1221 | Protein_1224 | IS3 family transposase | - |
| OKX01_RS06315 (OKX01_06315) | 1378381..1379262 | + | 882 | WP_264672632.1 | hypothetical protein | - |
| OKX01_RS06320 (OKX01_06320) | 1379268..1379738 | + | 471 | WP_264672633.1 | hypothetical protein | - |
| OKX01_RS06325 (OKX01_06325) | 1379944..1380249 | - | 306 | WP_264672634.1 | putative addiction module antidote protein | Antitoxin |
| OKX01_RS06330 (OKX01_06330) | 1380246..1380551 | - | 306 | WP_264672635.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OKX01_RS06335 (OKX01_06335) | 1381071..1382447 | + | 1377 | WP_264672636.1 | FAD-dependent oxidoreductase | - |
| OKX01_RS06340 (OKX01_06340) | 1382706..1383281 | + | 576 | WP_108727216.1 | TetR/AcrR family transcriptional regulator | - |
| OKX01_RS06345 (OKX01_06345) | 1383369..1383470 | + | 102 | Protein_1231 | hypothetical protein | - |
| OKX01_RS06350 (OKX01_06350) | 1383509..1384213 | - | 705 | WP_125277628.1 | SDR family oxidoreductase | - |
| OKX01_RS06355 (OKX01_06355) | 1384317..1385189 | + | 873 | WP_094196162.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11497.26 Da Isoelectric Point: 10.2587
>T263120 WP_264672635.1 NZ_CP110108:c1380551-1380246 [Alcaligenes sp. SMD-FA]
MNTINRSETFSTWLIGLKDLKARAKIVVRIKQASLGNFGDVKPISDGVYEMRIHFGPGYRLYYAREGRVVYLLLSGGDKS
SQKQDIKTAIAMWKQIQEDQS
MNTINRSETFSTWLIGLKDLKARAKIVVRIKQASLGNFGDVKPISDGVYEMRIHFGPGYRLYYAREGRVVYLLLSGGDKS
SQKQDIKTAIAMWKQIQEDQS
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|