Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3672267..3672888 Replicon chromosome
Accession NZ_CP110102
Organism Serratia marcescens strain SARVS06

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag OKB57_RS17760 Protein ID WP_004940313.1
Coordinates 3672685..3672888 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag OKB57_RS17755 Protein ID WP_004940312.1
Coordinates 3672267..3672635 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKB57_RS17725 (OKB57_17725) 3668366..3668620 + 255 WP_004940303.1 type B 50S ribosomal protein L31 -
OKB57_RS17730 (OKB57_17730) 3668633..3668773 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
OKB57_RS17735 (OKB57_17735) 3668881..3669759 - 879 WP_118892385.1 metal ABC transporter substrate-binding protein -
OKB57_RS17740 (OKB57_17740) 3669785..3670642 - 858 WP_044031827.1 metal ABC transporter permease -
OKB57_RS17745 (OKB57_17745) 3670639..3671352 - 714 WP_118892386.1 ABC transporter ATP-binding protein -
OKB57_RS17750 (OKB57_17750) 3671755..3672108 + 354 WP_004940311.1 hypothetical protein -
OKB57_RS17755 (OKB57_17755) 3672267..3672635 + 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
OKB57_RS17760 (OKB57_17760) 3672685..3672888 + 204 WP_004940313.1 HHA domain-containing protein Toxin
OKB57_RS17770 (OKB57_17770) 3673472..3673786 + 315 WP_015376856.1 MGMT family protein -
OKB57_RS17775 (OKB57_17775) 3673851..3674342 - 492 WP_015376855.1 YbaY family lipoprotein -
OKB57_RS17780 (OKB57_17780) 3674574..3675437 + 864 WP_015376854.1 acyl-CoA thioesterase II -
OKB57_RS17785 (OKB57_17785) 3675528..3676814 - 1287 WP_004940322.1 ammonium transporter AmtB -
OKB57_RS17790 (OKB57_17790) 3676851..3677189 - 339 WP_004940327.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T263118 WP_004940313.1 NZ_CP110102:3672685-3672888 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT263118 WP_004940312.1 NZ_CP110102:3672267-3672635 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References