Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1684338..1684966 Replicon chromosome
Accession NZ_CP110102
Organism Serratia marcescens strain SARVS06

Toxin (Protein)


Gene name hicA Uniprot ID A0A0P0QK57
Locus tag OKB57_RS08000 Protein ID WP_015378230.1
Coordinates 1684763..1684966 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A086GDG8
Locus tag OKB57_RS07995 Protein ID WP_015378231.1
Coordinates 1684338..1684751 (-) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKB57_RS07965 (OKB57_07965) 1679571..1680293 + 723 WP_004934752.1 RNA polymerase sigma factor FliA -
OKB57_RS07970 (OKB57_07970) 1680348..1680857 + 510 WP_004934751.1 flagella biosynthesis regulatory protein FliZ -
OKB57_RS07975 (OKB57_07975) 1680982..1681974 + 993 WP_015378235.1 D-cysteine desulfhydrase -
OKB57_RS07980 (OKB57_07980) 1682090..1682890 + 801 WP_015378234.1 cystine ABC transporter substrate-binding protein -
OKB57_RS07985 (OKB57_07985) 1682890..1683552 + 663 WP_118891942.1 cystine ABC transporter permease -
OKB57_RS07990 (OKB57_07990) 1683556..1684308 + 753 WP_015378232.1 L-cystine ABC transporter ATP-binding protein TcyN -
OKB57_RS07995 (OKB57_07995) 1684338..1684751 - 414 WP_015378231.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OKB57_RS08000 (OKB57_08000) 1684763..1684966 - 204 WP_015378230.1 type II toxin-antitoxin system HicA family toxin Toxin
OKB57_RS08005 (OKB57_08005) 1685133..1689104 - 3972 WP_015378229.1 trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliA / fliZ 1679571..1691159 11588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-129)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 7523.89 Da        Isoelectric Point: 11.1475

>T263111 WP_015378230.1 NZ_CP110102:c1684966-1684763 [Serratia marcescens]
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR

Download         Length: 204 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14888.63 Da        Isoelectric Point: 5.4867

>AT263111 WP_015378231.1 NZ_CP110102:c1684751-1684338 [Serratia marcescens]
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P0QK57

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDG8

References