Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 891239..891895 | Replicon | chromosome |
Accession | NZ_CP110102 | ||
Organism | Serratia marcescens strain SARVS06 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OKB57_RS04225 | Protein ID | WP_021504433.1 |
Coordinates | 891506..891895 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | OKB57_RS04220 | Protein ID | WP_004941563.1 |
Coordinates | 891239..891502 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB57_RS04200 (OKB57_04200) | 886277..887491 | - | 1215 | WP_015378743.1 | D-galactonate dehydratase family protein | - |
OKB57_RS04205 (OKB57_04205) | 887660..888565 | - | 906 | WP_015378742.1 | lipid kinase YegS | - |
OKB57_RS04210 (OKB57_04210) | 889032..890384 | - | 1353 | WP_004941558.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
OKB57_RS04215 (OKB57_04215) | 890563..890901 | - | 339 | WP_004941561.1 | YegP family protein | - |
OKB57_RS04220 (OKB57_04220) | 891239..891502 | + | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OKB57_RS04225 (OKB57_04225) | 891506..891895 | + | 390 | WP_021504433.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OKB57_RS04230 (OKB57_04230) | 891903..892619 | - | 717 | WP_015378739.1 | two-component system response regulator BaeR | - |
OKB57_RS04235 (OKB57_04235) | 892619..894000 | - | 1382 | Protein_825 | two-component system sensor histidine kinase BaeS | - |
OKB57_RS04240 (OKB57_04240) | 893997..895427 | - | 1431 | WP_103086182.1 | multidrug transporter subunit MdtD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14398.63 Da Isoelectric Point: 8.4983
>T263109 WP_021504433.1 NZ_CP110102:891506-891895 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|