Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2257659..2258311 Replicon chromosome
Accession NZ_CP110087
Organism Moraxella bovis strain SAM109242

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LP095_RS11445 Protein ID WP_264677325.1
Coordinates 2257659..2258051 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag LP095_RS11450 Protein ID WP_264675982.1
Coordinates 2258048..2258311 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LP095_RS11410 (LP095_11410) 2252752..2253693 + 942 WP_078275181.1 hydroxymethylbilane synthase -
LP095_RS11415 (LP095_11415) 2253739..2254617 + 879 WP_264677322.1 uroporphyrinogen-III synthase -
LP095_RS11420 (LP095_11420) 2254648..2255670 + 1023 WP_264677323.1 hypothetical protein -
LP095_RS11425 (LP095_11425) 2255749..2256207 + 459 WP_264677324.1 acyl-CoA thioesterase -
LP095_RS11430 (LP095_11430) 2256204..2256440 + 237 WP_078275185.1 sulfurtransferase TusA -
LP095_RS11435 (LP095_11435) 2256443..2257009 + 567 WP_078275186.1 hypothetical protein -
LP095_RS11440 (LP095_11440) 2257006..2257536 - 531 WP_264678418.1 glucose-6-phosphate 1-dehydrogenase family protein -
LP095_RS11445 (LP095_11445) 2257659..2258051 - 393 WP_264677325.1 type II toxin-antitoxin system VapC family toxin Toxin
LP095_RS11450 (LP095_11450) 2258048..2258311 - 264 WP_264675982.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LP095_RS11455 (LP095_11455) 2258391..2259650 - 1260 WP_264677326.1 replication-associated recombination protein A -
LP095_RS11460 (LP095_11460) 2259647..2260027 - 381 WP_264677327.1 type II toxin-antitoxin system VapC family toxin -
LP095_RS11465 (LP095_11465) 2260024..2260293 - 270 WP_264677328.1 hypothetical protein -
LP095_RS11470 (LP095_11470) 2260353..2260808 + 456 WP_264677329.1 type IV secretion protein Rhs -
LP095_RS11475 (LP095_11475) 2260873..2261145 - 273 WP_228157760.1 type II toxin-antitoxin system YafQ family toxin -
LP095_RS11480 (LP095_11480) 2261138..2261431 - 294 WP_264677330.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
LP095_RS11485 (LP095_11485) 2261575..2262909 - 1335 WP_264677331.1 deoxyguanosinetriphosphate triphosphohydrolase -
LP095_RS11490 (LP095_11490) 2263029..2263232 - 204 WP_115368689.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-122)

Antitoxin

SpoVT-AbrB domain

(10-50)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14629.69 Da        Isoelectric Point: 4.7370

>T263103 WP_264677325.1 NZ_CP110087:c2258051-2257659 [Moraxella bovis]
MKYLLDTNAVIAILNASERFLTTLERHKEREIAISSIVLSELYYGAYKSQKTAQNLEKINLLPFEVLQFNSQDADKAGEI
GATLERRGTPIGSYDTLIAGQAIANDLIVITDNVREFLRVDGLQIENWLK

Download         Length: 393 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10153.49 Da        Isoelectric Point: 6.3724

>AT263103 WP_264675982.1 NZ_CP110087:c2258311-2258048 [Moraxella bovis]
MRQTATAKLFWTGNSQAVRLPKAFRFEGTEVRIKKQGRQVIIEPAETQDWAWLDKLRAMPKDDSFEEAILEGRQNLKADE
RDWGAFE

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References