Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/YoeB-RelB
Location 1455112..1455601 Replicon chromosome
Accession NZ_CP110087
Organism Moraxella bovis strain SAM109242

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LP095_RS07490 Protein ID WP_264676856.1
Coordinates 1455112..1455369 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag LP095_RS07495 Protein ID WP_228157840.1
Coordinates 1455359..1455601 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LP095_RS07470 (LP095_07470) 1450140..1450988 + 849 WP_264676852.1 hypothetical protein -
LP095_RS07475 (LP095_07475) 1451091..1453577 + 2487 WP_264684011.1 alpha/beta hydrolase -
LP095_RS07480 (LP095_07480) 1453674..1454477 - 804 WP_264676854.1 UDP-2,3-diacylglucosamine diphosphatase -
LP095_RS07485 (LP095_07485) 1454544..1455053 - 510 WP_264676855.1 peptidylprolyl isomerase -
LP095_RS07490 (LP095_07490) 1455112..1455369 - 258 WP_264676856.1 Txe/YoeB family addiction module toxin Toxin
LP095_RS07495 (LP095_07495) 1455359..1455601 - 243 WP_228157840.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
LP095_RS07500 (LP095_07500) 1455646..1455810 + 165 WP_158079593.1 hypothetical protein -
LP095_RS07505 (LP095_07505) 1455892..1456179 - 288 WP_115005096.1 DUF1315 family protein -
LP095_RS07510 (LP095_07510) 1456202..1457149 - 948 WP_264676857.1 DUF853 domain-containing protein -
LP095_RS07515 (LP095_07515) 1457136..1457552 - 417 WP_264676858.1 DUF853 domain-containing protein -
LP095_RS07520 (LP095_07520) 1457465..1457722 - 258 WP_264676404.1 DUF853 domain-containing protein -
LP095_RS07525 (LP095_07525) 1457940..1458371 - 432 WP_264690204.1 bestrophin family protein -
LP095_RS07530 (LP095_07530) 1458337..1458549 - 213 WP_264676860.1 bestrophin family protein -
LP095_RS07535 (LP095_07535) 1458546..1459343 - 798 WP_264676861.1 polyphenol oxidase family protein -
LP095_RS07540 (LP095_07540) 1459462..1460511 - 1050 WP_264676261.1 RluA family pseudouridine synthase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-68)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10488.00 Da        Isoelectric Point: 8.1158

>T263101 WP_264676856.1 NZ_CP110087:c1455369-1455112 [Moraxella bovis]
MRIRWFDEVWEDYLYWQSQDKKTIKRINTLIKDCRRDPFDGIGKPEPLKYNLTGYWLRRINDANRLVYCCESETLIISCR
HHYEA

Download         Length: 258 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9134.23 Da        Isoelectric Point: 6.2120

>AT263101 WP_228157840.1 NZ_CP110087:c1455601-1455359 [Moraxella bovis]
MNYSEFRQNLASALDYVQDSHAPVIVKRGKHSAVVISLDEYNAFKETDYLLSNPANAEHLMRGVQAVKNRQLTQRDLIED

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References