Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 762091..762668 | Replicon | chromosome |
Accession | NZ_CP110087 | ||
Organism | Moraxella bovis strain SAM109242 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LP095_RS04010 | Protein ID | WP_078275234.1 |
Coordinates | 762333..762668 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LP095_RS04005 | Protein ID | WP_078275235.1 |
Coordinates | 762091..762333 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LP095_RS03985 (LP095_03985) | 757711..758433 | + | 723 | WP_264678018.1 | tRNA pseudouridine(65) synthase TruC | - |
LP095_RS03990 (LP095_03990) | 758681..759643 | - | 963 | Protein_782 | RNA-guided endonuclease TnpB family protein | - |
LP095_RS03995 (LP095_03995) | 759853..760465 | - | 613 | Protein_783 | IS607 family transposase | - |
LP095_RS04000 (LP095_04000) | 760805..761884 | - | 1080 | WP_264678019.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
LP095_RS04005 (LP095_04005) | 762091..762333 | + | 243 | WP_078275235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LP095_RS04010 (LP095_04010) | 762333..762668 | + | 336 | WP_078275234.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LP095_RS04015 (LP095_04015) | 762730..763725 | + | 996 | WP_208624081.1 | polyprenyl synthetase family protein | - |
LP095_RS04020 (LP095_04020) | 763749..763985 | + | 237 | WP_264678020.1 | hypothetical protein | - |
LP095_RS04025 (LP095_04025) | 764075..766219 | - | 2145 | WP_264678021.1 | cation-translocating P-type ATPase | - |
LP095_RS04030 (LP095_04030) | 766486..766914 | - | 429 | WP_268194266.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13059.98 Da Isoelectric Point: 8.8194
>T263099 WP_078275234.1 NZ_CP110087:762333-762668 [Moraxella bovis]
MCELMYELEFDERALKEWQKLGDTIKTQFKKRLAKVLKNPHIIANRLSGGQNLYKINFRSAGYRLVYQVEDDKVVVFVIV
MGKREKNAVYDTAEEWLAERQSDNQDTQSVK
MCELMYELEFDERALKEWQKLGDTIKTQFKKRLAKVLKNPHIIANRLSGGQNLYKINFRSAGYRLVYQVEDDKVVVFVIV
MGKREKNAVYDTAEEWLAERQSDNQDTQSVK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|