Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 643927..644576 | Replicon | chromosome |
Accession | NZ_CP110087 | ||
Organism | Moraxella bovis strain SAM109242 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LP095_RS03370 | Protein ID | WP_264677937.1 |
Coordinates | 644175..644576 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LP095_RS03365 | Protein ID | WP_112741908.1 |
Coordinates | 643927..644160 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LP095_RS03345 (LP095_03345) | 639323..639772 | - | 450 | WP_264683685.1 | cytochrome c | - |
LP095_RS03350 (LP095_03350) | 639954..640946 | - | 993 | WP_264683684.1 | oxygen-dependent coproporphyrinogen oxidase | - |
LP095_RS03355 (LP095_03355) | 640966..641559 | - | 594 | WP_208624078.1 | GTP cyclohydrolase II | - |
LP095_RS03360 (LP095_03360) | 641780..643879 | + | 2100 | WP_264683682.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
LP095_RS03365 (LP095_03365) | 643927..644160 | + | 234 | WP_112741908.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LP095_RS03370 (LP095_03370) | 644175..644576 | + | 402 | WP_264677937.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LP095_RS03375 (LP095_03375) | 645100..645600 | + | 501 | WP_112741909.1 | WG repeat-containing protein | - |
LP095_RS03380 (LP095_03380) | 645722..646552 | + | 831 | WP_264677938.1 | inositol monophosphatase family protein | - |
LP095_RS03385 (LP095_03385) | 646652..647341 | - | 690 | WP_264677939.1 | SIMPL domain-containing protein | - |
LP095_RS03395 (LP095_03395) | 648079..648498 | - | 420 | WP_264677940.1 | S4 domain-containing protein | - |
LP095_RS03400 (LP095_03400) | 648750..648923 | - | 174 | WP_264677941.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15071.29 Da Isoelectric Point: 6.8426
>T263098 WP_264677937.1 NZ_CP110087:644175-644576 [Moraxella bovis]
MFSFMLDTNICIYVIKERPIKALNKFNQYAGRICVSSIVASELYFGAYNSQFMDKNLHQVEDFLSRLTVLDYTAECSPHY
GEICADLTKQGKLISENDIHIASHARALGLTLITNNTDEFKRVSGLRIGNWAI
MFSFMLDTNICIYVIKERPIKALNKFNQYAGRICVSSIVASELYFGAYNSQFMDKNLHQVEDFLSRLTVLDYTAECSPHY
GEICADLTKQGKLISENDIHIASHARALGLTLITNNTDEFKRVSGLRIGNWAI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|