Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 205311..205935 | Replicon | chromosome |
| Accession | NZ_CP110087 | ||
| Organism | Moraxella bovis strain SAM109242 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | LP095_RS01090 | Protein ID | WP_264677651.1 |
| Coordinates | 205311..205613 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LP095_RS01095 | Protein ID | WP_264677652.1 |
| Coordinates | 205600..205935 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LP095_RS01065 (LP095_01065) | 200405..200959 | + | 555 | WP_078274416.1 | porin family protein | - |
| LP095_RS01070 (LP095_01070) | 201216..202571 | - | 1356 | WP_272506296.1 | FAD-dependent oxidoreductase | - |
| LP095_RS01080 (LP095_01080) | 202590..203708 | - | 1119 | WP_264677649.1 | acyl-CoA dehydrogenase family protein | - |
| LP095_RS01085 (LP095_01085) | 203818..205173 | - | 1356 | WP_264677650.1 | anthranilate synthase component I family protein | - |
| LP095_RS01090 (LP095_01090) | 205311..205613 | + | 303 | WP_264677651.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LP095_RS01095 (LP095_01095) | 205600..205935 | + | 336 | WP_264677652.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LP095_RS01100 (LP095_01100) | 205968..206432 | - | 465 | WP_264677653.1 | hypothetical protein | - |
| LP095_RS01105 (LP095_01105) | 206620..207852 | - | 1233 | WP_264677654.1 | beta-ketoacyl-ACP synthase II | - |
| LP095_RS01110 (LP095_01110) | 208027..208767 | - | 741 | WP_112742704.1 | single-stranded DNA-binding protein | - |
| LP095_RS01115 (LP095_01115) | 209227..209544 | - | 318 | WP_078274423.1 | H-NS histone family protein | - |
| LP095_RS01120 (LP095_01120) | 209753..210823 | - | 1071 | WP_115368772.1 | 5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11427.89 Da Isoelectric Point: 6.3267
>T263097 WP_264677651.1 NZ_CP110087:205311-205613 [Moraxella bovis]
MTKSDKLKAKLYGDVRTFVFSDLVTLLSQLGYEMHERAGSRVVFVHCDDNSDRIHLHKPHPENTIKGGALKAVKAYLSEK
GYFDEFNDDVLNQELKNDDL
MTKSDKLKAKLYGDVRTFVFSDLVTLLSQLGYEMHERAGSRVVFVHCDDNSDRIHLHKPHPENTIKGGALKAVKAYLSEK
GYFDEFNDDVLNQELKNDDL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|