Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 25369..26163 | Replicon | plasmid p1WJP83 |
Accession | NZ_CP110081 | ||
Organism | Buttiauxella sp. WJP83 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | OH773_RS21870 | Protein ID | WP_270146300.1 |
Coordinates | 25369..25890 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | - |
Locus tag | OH773_RS21875 | Protein ID | WP_270146302.1 |
Coordinates | 25894..26163 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH773_RS21840 (OH773_21840) | 22121..22702 | + | 582 | WP_270146287.1 | tail fiber assembly protein | - |
OH773_RS21845 (OH773_21845) | 22777..23100 | + | 324 | WP_270146289.1 | hypothetical protein | - |
OH773_RS21850 (OH773_21850) | 23112..23804 | + | 693 | WP_270146291.1 | hypothetical protein | - |
OH773_RS21855 (OH773_21855) | 23806..24057 | + | 252 | WP_270146293.1 | hypothetical protein | - |
OH773_RS21860 (OH773_21860) | 24050..24214 | + | 165 | WP_270146295.1 | hypothetical protein | - |
OH773_RS21865 (OH773_21865) | 24391..25227 | + | 837 | WP_270146297.1 | restriction endonuclease | - |
OH773_RS21870 (OH773_21870) | 25369..25890 | - | 522 | WP_270146300.1 | GNAT family N-acetyltransferase | Toxin |
OH773_RS21875 (OH773_21875) | 25894..26163 | - | 270 | WP_270146302.1 | DUF1778 domain-containing protein | Antitoxin |
OH773_RS21880 (OH773_21880) | 26487..27152 | + | 666 | WP_270146304.1 | AAA family ATPase | - |
OH773_RS21885 (OH773_21885) | 27158..27511 | + | 354 | WP_270146377.1 | hypothetical protein | - |
OH773_RS21890 (OH773_21890) | 27555..28349 | - | 795 | WP_270146306.1 | DUF2971 domain-containing protein | - |
OH773_RS21895 (OH773_21895) | 28619..29344 | + | 726 | WP_270146308.1 | hypothetical protein | - |
OH773_RS21900 (OH773_21900) | 29405..30745 | + | 1341 | WP_270146310.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..111544 | 111544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19272.98 Da Isoelectric Point: 6.9681
>T263096 WP_270146300.1 NZ_CP110081:c25890-25369 [Buttiauxella sp. WJP83]
VADLTIEIFSEGNEYDFSDFDCGEESLNVFLTDHLARQHSGRILRGYLLLTKDPKPKVLGYYTLSGSCFEKATLPSKTQQ
RKVPYSNVPSVTLGRLAVHKDLQGKEWGTTLVTHAMKVVYSASLAVGVHGMFVDALNDGAKRFYTKLGFIPLVGDNTNSL
FYPTKSIEKLFEE
VADLTIEIFSEGNEYDFSDFDCGEESLNVFLTDHLARQHSGRILRGYLLLTKDPKPKVLGYYTLSGSCFEKATLPSKTQQ
RKVPYSNVPSVTLGRLAVHKDLQGKEWGTTLVTHAMKVVYSASLAVGVHGMFVDALNDGAKRFYTKLGFIPLVGDNTNSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|