Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3605577..3606199 | Replicon | chromosome |
Accession | NZ_CP110080 | ||
Organism | Buttiauxella sp. WJP83 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | OH773_RS16670 | Protein ID | WP_121265420.1 |
Coordinates | 3605981..3606199 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A1B7HUH8 |
Locus tag | OH773_RS16665 | Protein ID | WP_034458068.1 |
Coordinates | 3605577..3605951 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH773_RS16655 (OH773_16655) | 3600655..3601854 | + | 1200 | WP_270140154.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OH773_RS16660 (OH773_16660) | 3601877..3605026 | + | 3150 | WP_270140156.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OH773_RS16665 (OH773_16665) | 3605577..3605951 | + | 375 | WP_034458068.1 | Hha toxicity modulator TomB | Antitoxin |
OH773_RS16670 (OH773_16670) | 3605981..3606199 | + | 219 | WP_121265420.1 | HHA domain-containing protein | Toxin |
OH773_RS16675 (OH773_16675) | 3606370..3606936 | + | 567 | WP_270140161.1 | maltose O-acetyltransferase | - |
OH773_RS16680 (OH773_16680) | 3607039..3607497 | + | 459 | WP_270140163.1 | YlaC family protein | - |
OH773_RS16685 (OH773_16685) | 3607538..3607678 | - | 141 | WP_034458060.1 | type B 50S ribosomal protein L36 | - |
OH773_RS16690 (OH773_16690) | 3607996..3609033 | + | 1038 | WP_270140167.1 | isopenicillin N synthase family oxygenase | - |
OH773_RS16695 (OH773_16695) | 3609052..3609861 | + | 810 | WP_270140169.1 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
OH773_RS16700 (OH773_16700) | 3609858..3610649 | + | 792 | WP_270140172.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8624.06 Da Isoelectric Point: 9.4828
>T263094 WP_121265420.1 NZ_CP110080:3605981-3606199 [Buttiauxella sp. WJP83]
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14512.27 Da Isoelectric Point: 4.7295
>AT263094 WP_034458068.1 NZ_CP110080:3605577-3605951 [Buttiauxella sp. WJP83]
MDEYSPKRHDIAQLKFLCENLYHDCLTNLGESNHGWVNDPTSAINLQLNELIEHIAAFALNYKIKYDDESKLIEQIDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVTESRANPVSLSF
MDEYSPKRHDIAQLKFLCENLYHDCLTNLGESNHGWVNDPTSAINLQLNELIEHIAAFALNYKIKYDDESKLIEQIDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVTESRANPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|