Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3524962..3525617 | Replicon | chromosome |
Accession | NZ_CP110080 | ||
Organism | Buttiauxella sp. WJP83 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OH773_RS16325 | Protein ID | WP_270145917.1 |
Coordinates | 3524962..3525354 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OH773_RS16330 | Protein ID | WP_270140035.1 |
Coordinates | 3525354..3525617 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH773_RS16295 (OH773_16295) | 3520509..3521294 | + | 786 | WP_270140024.1 | transcriptional regulator LldR | - |
OH773_RS16300 (OH773_16300) | 3521291..3522472 | + | 1182 | WP_270140026.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
OH773_RS16305 (OH773_16305) | 3522535..3522963 | - | 429 | WP_270140028.1 | OsmC family protein | - |
OH773_RS16310 (OH773_16310) | 3523122..3523655 | + | 534 | WP_270140030.1 | tetratricopeptide repeat protein | - |
OH773_RS16315 (OH773_16315) | 3523745..3524194 | + | 450 | WP_270145915.1 | RNA polymerase sigma factor | - |
OH773_RS16320 (OH773_16320) | 3524191..3524934 | + | 744 | WP_270140032.1 | anti-sigma factor | - |
OH773_RS16325 (OH773_16325) | 3524962..3525354 | - | 393 | WP_270145917.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH773_RS16330 (OH773_16330) | 3525354..3525617 | - | 264 | WP_270140035.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OH773_RS16335 (OH773_16335) | 3525887..3526168 | - | 282 | WP_270140037.1 | acetolactate synthase small subunit | - |
OH773_RS16340 (OH773_16340) | 3526172..3527860 | - | 1689 | WP_270140039.1 | acetolactate synthase large subunit | - |
OH773_RS16345 (OH773_16345) | 3527972..3528070 | - | 99 | WP_183271233.1 | ilvB operon leader peptide IvbL | - |
OH773_RS16350 (OH773_16350) | 3528200..3529222 | - | 1023 | WP_270140042.1 | GTP-binding protein | - |
OH773_RS16355 (OH773_16355) | 3529238..3529435 | - | 198 | WP_034456870.1 | YbdD/YjiX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14270.49 Da Isoelectric Point: 8.4392
>T263093 WP_270145917.1 NZ_CP110080:c3525354-3524962 [Buttiauxella sp. WJP83]
MAYMLDTNTVSYFLRQHPQIVARISAVPPSSISISSITEAELLFGVEKRRNKALKTAVMGFLDAVSIYEWDSAAAQTYGK
LRASMEKKGHVMGALDMLIAAHALSEKTTLITSDRAFYGVAGLQVQDWTV
MAYMLDTNTVSYFLRQHPQIVARISAVPPSSISISSITEAELLFGVEKRRNKALKTAVMGFLDAVSIYEWDSAAAQTYGK
LRASMEKKGHVMGALDMLIAAHALSEKTTLITSDRAFYGVAGLQVQDWTV
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|