Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 2494396..2495030 | Replicon | chromosome |
Accession | NZ_CP110080 | ||
Organism | Buttiauxella sp. WJP83 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OH773_RS11560 | Protein ID | WP_270138761.1 |
Coordinates | 2494396..2494671 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OH773_RS11565 | Protein ID | WP_270145825.1 |
Coordinates | 2494683..2495030 (+) | Length | 116 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH773_RS11535 (OH773_11535) | 2489725..2490318 | - | 594 | WP_270145820.1 | tellurite resistance methyltransferase TehB | - |
OH773_RS11540 (OH773_11540) | 2490314..2491303 | - | 990 | WP_270138754.1 | dicarboxylate transporter/tellurite-resistance protein TehA | - |
OH773_RS11545 (OH773_11545) | 2491424..2492353 | + | 930 | WP_270138756.1 | YdcK family protein | - |
OH773_RS11550 (OH773_11550) | 2492377..2492889 | - | 513 | WP_270145823.1 | 50S ribosomal protein L7/L12-serine acetyltransferase | - |
OH773_RS11555 (OH773_11555) | 2493123..2494280 | + | 1158 | WP_270138759.1 | FAD-dependent urate hydroxylase HpxO | - |
OH773_RS11560 (OH773_11560) | 2494396..2494671 | + | 276 | WP_270138761.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OH773_RS11565 (OH773_11565) | 2494683..2495030 | + | 348 | WP_270145825.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OH773_RS11570 (OH773_11570) | 2495067..2496722 | - | 1656 | WP_270138763.1 | glucan biosynthesis protein | - |
OH773_RS11575 (OH773_11575) | 2496978..2497754 | - | 777 | WP_270138765.1 | ABC transporter substrate-binding protein | - |
OH773_RS11580 (OH773_11580) | 2497767..2498936 | - | 1170 | WP_270138767.1 | pyridoxal phosphate-dependent aminotransferase | - |
OH773_RS11585 (OH773_11585) | 2499059..2499919 | + | 861 | WP_270138769.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10316.84 Da Isoelectric Point: 10.4734
>T263092 WP_270138761.1 NZ_CP110080:2494396-2494671 [Buttiauxella sp. WJP83]
MGYDKDFLRNKHQGTLKQIFAKPTSTSIRWQDVEMLIIALNGEVRSGKGSRVRFLLKGSIAHFHRPHPSPETDKGAIVNL
QEWFESIGVTP
MGYDKDFLRNKHQGTLKQIFAKPTSTSIRWQDVEMLIIALNGEVRSGKGSRVRFLLKGSIAHFHRPHPSPETDKGAIVNL
QEWFESIGVTP
Download Length: 276 bp
Antitoxin
Download Length: 116 a.a. Molecular weight: 12924.06 Da Isoelectric Point: 4.9009
>AT263092 WP_270145825.1 NZ_CP110080:2494683-2495030 [Buttiauxella sp. WJP83]
MIPNTMVICGQPALITWVPEIGLFRGKFLGLSGYCDFVADSAKGLMAEGELSLKEYLDDCKTSGIDPYEREEKIKTFTLR
YPESFGERLAIAAAEQRMSVNSYIVEMLSKQMKLK
MIPNTMVICGQPALITWVPEIGLFRGKFLGLSGYCDFVADSAKGLMAEGELSLKEYLDDCKTSGIDPYEREEKIKTFTLR
YPESFGERLAIAAAEQRMSVNSYIVEMLSKQMKLK
Download Length: 348 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|