Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 776350..777019 | Replicon | chromosome |
| Accession | NZ_CP110080 | ||
| Organism | Buttiauxella sp. WJP83 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OH773_RS03675 | Protein ID | WP_270143122.1 |
| Coordinates | 776597..777019 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A1B7I271 |
| Locus tag | OH773_RS03670 | Protein ID | WP_064513590.1 |
| Coordinates | 776350..776616 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH773_RS03650 (OH773_03650) | 771773..773206 | - | 1434 | WP_270143113.1 | 6-phospho-beta-glucosidase | - |
| OH773_RS03655 (OH773_03655) | 773372..774100 | - | 729 | WP_183270561.1 | MurR/RpiR family transcriptional regulator | - |
| OH773_RS03660 (OH773_03660) | 774292..774945 | + | 654 | WP_270143116.1 | hemolysin III family protein | - |
| OH773_RS03665 (OH773_03665) | 774988..775977 | - | 990 | WP_270143118.1 | tRNA-modifying protein YgfZ | - |
| OH773_RS03670 (OH773_03670) | 776350..776616 | + | 267 | WP_064513590.1 | FAD assembly factor SdhE | Antitoxin |
| OH773_RS03675 (OH773_03675) | 776597..777019 | + | 423 | WP_270143122.1 | protein YgfX | Toxin |
| OH773_RS03680 (OH773_03680) | 777027..777548 | - | 522 | WP_183270557.1 | flavodoxin FldB | - |
| OH773_RS03685 (OH773_03685) | 777684..778580 | + | 897 | WP_270143124.1 | site-specific tyrosine recombinase XerD | - |
| OH773_RS03690 (OH773_03690) | 778605..779321 | + | 717 | WP_270143126.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OH773_RS03695 (OH773_03695) | 779329..781062 | + | 1734 | WP_270143128.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16688.71 Da Isoelectric Point: 10.8200
>T263085 WP_270143122.1 NZ_CP110080:776597-777019 [Buttiauxella sp. WJP83]
VVLWQSDLRVSWRAQWISLLVHGMIALFVLLMPWPMSYTLIWMLLLSLVVFDSVRSQRRIHACQGEMKLLTDYHLRWQNQ
EWEIVGAPWVLRSGMMLRLRRLGRKRCQHLWLSADSMDIGEWRDLRRLMQQQQASGSGEV
VVLWQSDLRVSWRAQWISLLVHGMIALFVLLMPWPMSYTLIWMLLLSLVVFDSVRSQRRIHACQGEMKLLTDYHLRWQNQ
EWEIVGAPWVLRSGMMLRLRRLGRKRCQHLWLSADSMDIGEWRDLRRLMQQQQASGSGEV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|