Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 275596..276218 | Replicon | chromosome |
| Accession | NZ_CP110080 | ||
| Organism | Buttiauxella sp. WJP83 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OH773_RS01220 | Protein ID | WP_270142319.1 |
| Coordinates | 275596..275976 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OH773_RS01225 | Protein ID | WP_270142321.1 |
| Coordinates | 275976..276218 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH773_RS01200 (OH773_01200) | 272115..273020 | + | 906 | WP_183272268.1 | formate dehydrogenase subunit beta | - |
| OH773_RS01205 (OH773_01205) | 273017..273652 | + | 636 | WP_183272269.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OH773_RS01210 (OH773_01210) | 273649..274578 | + | 930 | WP_270142315.1 | formate dehydrogenase accessory protein FdhE | - |
| OH773_RS01215 (OH773_01215) | 274683..275591 | + | 909 | WP_270142317.1 | alpha/beta hydrolase | - |
| OH773_RS01220 (OH773_01220) | 275596..275976 | - | 381 | WP_270142319.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH773_RS01225 (OH773_01225) | 275976..276218 | - | 243 | WP_270142321.1 | CopG family transcriptional regulator | Antitoxin |
| OH773_RS01230 (OH773_01230) | 276420..276629 | - | 210 | WP_270146030.1 | YgdI/YgdR family lipoprotein | - |
| OH773_RS01235 (OH773_01235) | 276809..277057 | + | 249 | WP_270142322.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| OH773_RS01240 (OH773_01240) | 277054..277320 | + | 267 | WP_270142323.1 | Txe/YoeB family addiction module toxin | - |
| OH773_RS01245 (OH773_01245) | 277433..277807 | - | 375 | WP_183272274.1 | hypothetical protein | - |
| OH773_RS01250 (OH773_01250) | 278033..278377 | - | 345 | WP_270142326.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| OH773_RS01255 (OH773_01255) | 278768..279298 | - | 531 | WP_270142328.1 | hypothetical protein | - |
| OH773_RS01260 (OH773_01260) | 279431..279616 | + | 186 | WP_270142330.1 | toxin-antitoxin system HicB family antitoxin | - |
| OH773_RS01265 (OH773_01265) | 279736..280995 | + | 1260 | WP_270142332.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13860.12 Da Isoelectric Point: 7.9863
>T263083 WP_270142319.1 NZ_CP110080:c275976-275596 [Buttiauxella sp. WJP83]
MVESSAIFDTNILIDYLNGVPEAKVALTAYGSKPAISVITWIEVMVGAKRFGHEQQTKQFLSGFDVLPVNQAVSEQAVET
RQEYGMKLPDAIILATAKVNLKRLITRNSKDFKNIPGVVMPYSLAC
MVESSAIFDTNILIDYLNGVPEAKVALTAYGSKPAISVITWIEVMVGAKRFGHEQQTKQFLSGFDVLPVNQAVSEQAVET
RQEYGMKLPDAIILATAKVNLKRLITRNSKDFKNIPGVVMPYSLAC
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|