Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 275596..276218 Replicon chromosome
Accession NZ_CP110080
Organism Buttiauxella sp. WJP83

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OH773_RS01220 Protein ID WP_270142319.1
Coordinates 275596..275976 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag OH773_RS01225 Protein ID WP_270142321.1
Coordinates 275976..276218 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH773_RS01200 (OH773_01200) 272115..273020 + 906 WP_183272268.1 formate dehydrogenase subunit beta -
OH773_RS01205 (OH773_01205) 273017..273652 + 636 WP_183272269.1 formate dehydrogenase cytochrome b556 subunit -
OH773_RS01210 (OH773_01210) 273649..274578 + 930 WP_270142315.1 formate dehydrogenase accessory protein FdhE -
OH773_RS01215 (OH773_01215) 274683..275591 + 909 WP_270142317.1 alpha/beta hydrolase -
OH773_RS01220 (OH773_01220) 275596..275976 - 381 WP_270142319.1 type II toxin-antitoxin system VapC family toxin Toxin
OH773_RS01225 (OH773_01225) 275976..276218 - 243 WP_270142321.1 CopG family transcriptional regulator Antitoxin
OH773_RS01230 (OH773_01230) 276420..276629 - 210 WP_270146030.1 YgdI/YgdR family lipoprotein -
OH773_RS01235 (OH773_01235) 276809..277057 + 249 WP_270142322.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
OH773_RS01240 (OH773_01240) 277054..277320 + 267 WP_270142323.1 Txe/YoeB family addiction module toxin -
OH773_RS01245 (OH773_01245) 277433..277807 - 375 WP_183272274.1 hypothetical protein -
OH773_RS01250 (OH773_01250) 278033..278377 - 345 WP_270142326.1 type II toxin-antitoxin system HicB family antitoxin -
OH773_RS01255 (OH773_01255) 278768..279298 - 531 WP_270142328.1 hypothetical protein -
OH773_RS01260 (OH773_01260) 279431..279616 + 186 WP_270142330.1 toxin-antitoxin system HicB family antitoxin -
OH773_RS01265 (OH773_01265) 279736..280995 + 1260 WP_270142332.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(15-49)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13860.12 Da        Isoelectric Point: 7.9863

>T263083 WP_270142319.1 NZ_CP110080:c275976-275596 [Buttiauxella sp. WJP83]
MVESSAIFDTNILIDYLNGVPEAKVALTAYGSKPAISVITWIEVMVGAKRFGHEQQTKQFLSGFDVLPVNQAVSEQAVET
RQEYGMKLPDAIILATAKVNLKRLITRNSKDFKNIPGVVMPYSLAC

Download         Length: 381 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9405.60 Da        Isoelectric Point: 4.3529

>AT263083 WP_270142321.1 NZ_CP110080:c276218-275976 [Buttiauxella sp. WJP83]
MATLFGEMMGRILLDLSDEVVRRLDDLKQSRNLPRAELLREAVDEYLERHTQVAVTEAFGLWSEHAVDGVEYERTLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References