263082

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 54567..55138 Replicon plasmid pBE5_2
Accession NZ_CP110076
Organism Enterococcus faecalis strain BE5

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag OLM06_RS14865 Protein ID WP_002362432.1
Coordinates 54567..54908 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag OLM06_RS14870 Protein ID WP_002362431.1
Coordinates 54908..55138 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLM06_RS14845 (OLM06_14825) 49966..51249 - 1284 WP_002362438.1 hypothetical protein -
OLM06_RS14855 (OLM06_14835) 52650..53252 - 603 WP_002362434.1 Fic family protein -
OLM06_RS14860 (OLM06_14840) 53517..54455 - 939 WP_002362433.1 hypothetical protein -
OLM06_RS14865 (OLM06_14845) 54567..54908 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OLM06_RS14870 (OLM06_14850) 54908..55138 - 231 WP_002362431.1 hypothetical protein Antitoxin
OLM06_RS14875 (OLM06_14855) 55342..55962 + 621 WP_002367784.1 recombinase family protein -
OLM06_RS14880 (OLM06_14860) 55952..56266 + 315 WP_002367785.1 hypothetical protein -
OLM06_RS14885 (OLM06_14865) 56260..56466 + 207 WP_002367786.1 hypothetical protein -
OLM06_RS14890 (OLM06_14870) 56626..56820 + 195 WP_002367787.1 hypothetical protein -
OLM06_RS14895 (OLM06_14875) 56832..57023 + 192 WP_002367788.1 hypothetical protein -
OLM06_RS14900 (OLM06_14880) 57193..57408 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
OLM06_RS14905 (OLM06_14885) 57409..57750 + 342 WP_002367792.1 bacteriocin immunity protein -
OLM06_RS14910 (OLM06_14890) 58166..58684 + 519 WP_002367793.1 hypothetical protein -
OLM06_RS14915 (OLM06_14895) 58632..58847 + 216 WP_002415356.1 hypothetical protein -
OLM06_RS14920 (OLM06_14900) 58939..59025 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
OLM06_RS14925 (OLM06_14905) 59282..59578 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / str - 1..62694 62694


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T263082 WP_002362432.1 NZ_CP110076:c54908-54567 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT263082 WP_002362431.1 NZ_CP110076:c55138-54908 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References