Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 54567..55138 | Replicon | plasmid pBE5_2 |
| Accession | NZ_CP110076 | ||
| Organism | Enterococcus faecalis strain BE5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | OLM06_RS14865 | Protein ID | WP_002362432.1 |
| Coordinates | 54567..54908 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | OLM06_RS14870 | Protein ID | WP_002362431.1 |
| Coordinates | 54908..55138 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM06_RS14845 (OLM06_14825) | 49966..51249 | - | 1284 | WP_002362438.1 | hypothetical protein | - |
| OLM06_RS14855 (OLM06_14835) | 52650..53252 | - | 603 | WP_002362434.1 | Fic family protein | - |
| OLM06_RS14860 (OLM06_14840) | 53517..54455 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| OLM06_RS14865 (OLM06_14845) | 54567..54908 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OLM06_RS14870 (OLM06_14850) | 54908..55138 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| OLM06_RS14875 (OLM06_14855) | 55342..55962 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| OLM06_RS14880 (OLM06_14860) | 55952..56266 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| OLM06_RS14885 (OLM06_14865) | 56260..56466 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| OLM06_RS14890 (OLM06_14870) | 56626..56820 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| OLM06_RS14895 (OLM06_14875) | 56832..57023 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| OLM06_RS14900 (OLM06_14880) | 57193..57408 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| OLM06_RS14905 (OLM06_14885) | 57409..57750 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| OLM06_RS14910 (OLM06_14890) | 58166..58684 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| OLM06_RS14915 (OLM06_14895) | 58632..58847 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| OLM06_RS14920 (OLM06_14900) | 58939..59025 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| OLM06_RS14925 (OLM06_14905) | 59282..59578 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / str | - | 1..62694 | 62694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T263082 WP_002362432.1 NZ_CP110076:c54908-54567 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |