Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2782979..2783550 | Replicon | chromosome |
| Accession | NZ_CP110074 | ||
| Organism | Enterococcus faecalis strain BE5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3GRA7 |
| Locus tag | OLM06_RS13750 | Protein ID | WP_002360937.1 |
| Coordinates | 2782979..2783320 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S4CGQ1 |
| Locus tag | OLM06_RS13755 | Protein ID | WP_002367500.1 |
| Coordinates | 2783320..2783550 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM06_RS13745 (2778994) | 2778994..2782608 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| OLM06_RS13750 (2782979) | 2782979..2783320 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OLM06_RS13755 (2783320) | 2783320..2783550 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
| OLM06_RS13760 (2783605) | 2783605..2783784 | - | 180 | WP_111997057.1 | hypothetical protein | - |
| OLM06_RS13765 (2783964) | 2783964..2784179 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| OLM06_RS13770 (2784318) | 2784318..2785310 | + | 993 | WP_002389493.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLM06_RS13775 (2785574) | 2785574..2786212 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| OLM06_RS13780 (2786898) | 2786898..2788514 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T263069 WP_002360937.1 NZ_CP110074:c2783320-2782979 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A7G9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4CGQ1 |