Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 412619..413201 | Replicon | chromosome |
Accession | NZ_CP110074 | ||
Organism | Enterococcus faecalis strain BE5 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLM06_RS02080 | Protein ID | WP_002355414.1 |
Coordinates | 412893..413201 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | OLM06_RS02075 | Protein ID | WP_002326825.1 |
Coordinates | 412619..412891 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM06_RS02045 (407900) | 407900..408628 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
OLM06_RS02050 (408805) | 408805..409731 | + | 927 | WP_002355406.1 | hypothetical protein | - |
OLM06_RS02055 (409748) | 409748..411031 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
OLM06_RS02060 (411223) | 411223..411345 | + | 123 | Protein_382 | topoisomerase | - |
OLM06_RS02065 (411420) | 411420..412316 | + | 897 | WP_002363034.1 | ParA family protein | - |
OLM06_RS02070 (412393) | 412393..412602 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
OLM06_RS02075 (412619) | 412619..412891 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
OLM06_RS02080 (412893) | 412893..413201 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLM06_RS02085 (413281) | 413281..413688 | - | 408 | WP_224571294.1 | tyrosine-type recombinase/integrase | - |
OLM06_RS02090 (413755) | 413755..414255 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
OLM06_RS02095 (414260) | 414260..415027 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLM06_RS02100 (415514) | 415514..415939 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLM06_RS02105 (415956) | 415956..416471 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLM06_RS02110 (416482) | 416482..417414 | + | 933 | WP_264563359.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | ClpL | bsh / esp | 380432..469769 | 89337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T263056 WP_002355414.1 NZ_CP110074:412893-413201 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |