Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1545670..1546807 | Replicon | chromosome |
Accession | NZ_CP110072 | ||
Organism | Enterococcus faecalis strain BE7 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | OLL88_RS07450 | Protein ID | WP_002401483.1 |
Coordinates | 1545944..1546807 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | OLL88_RS07445 | Protein ID | WP_000301765.1 |
Coordinates | 1545670..1545942 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL88_RS07415 (1542073) | 1542073..1543599 | + | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
OLL88_RS07420 (1543719) | 1543719..1543841 | + | 123 | Protein_1458 | peptide-binding protein | - |
OLL88_RS07425 (1543910) | 1543910..1544005 | + | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
OLL88_RS07430 (1544130) | 1544130..1544867 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
OLL88_RS07435 (1545037) | 1545037..1545297 | + | 261 | Protein_1461 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
OLL88_RS07440 (1545438) | 1545438..1545653 | + | 216 | WP_002295735.1 | peptide-binding protein | - |
OLL88_RS07445 (1545670) | 1545670..1545942 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
OLL88_RS07450 (1545944) | 1545944..1546807 | + | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
OLL88_RS07455 (1547248) | 1547248..1547565 | + | 318 | WP_002333463.1 | hypothetical protein | - |
OLL88_RS07460 (1547585) | 1547585..1547674 | + | 90 | Protein_1466 | DnaJ domain-containing protein | - |
OLL88_RS07465 (1547749) | 1547749..1548429 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
OLL88_RS07470 (1548411) | 1548411..1548647 | + | 237 | WP_264554385.1 | ketopantoate reductase C-terminal domain-containing protein | - |
OLL88_RS07475 (1548923) | 1548923..1549774 | + | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
OLL88_RS07480 (1549776) | 1549776..1550543 | + | 768 | WP_002357481.1 | ribonuclease HII | - |
OLL88_RS07485 (1550604) | 1550604..1551467 | + | 864 | WP_002382350.1 | DNA-processing protein DprA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia | - | 1504306..1541001 | 36695 | |
- | inside | IScluster/Tn | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) | - | 1521621..1548429 | 26808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T263050 WP_002401483.1 NZ_CP110072:1545944-1546807 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3Q8X | |
PDB | 1GVN | |
AlphaFold DB | A0A829F0A3 |