Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 1537084..1538192 | Replicon | chromosome |
| Accession | NZ_CP110072 | ||
| Organism | Enterococcus faecalis strain BE7 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | A0A193AUR0 |
| Locus tag | OLL88_RS07390 | Protein ID | WP_002378351.1 |
| Coordinates | 1537323..1538192 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | OLL88_RS07385 | Protein ID | WP_000205227.1 |
| Coordinates | 1537084..1537308 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL88_RS07365 (1532715) | 1532715..1534199 | + | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
| OLL88_RS07370 (1534253) | 1534253..1535056 | + | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| OLL88_RS07375 (1535365) | 1535365..1536666 | - | 1302 | Protein_1449 | ISL3 family transposase | - |
| OLL88_RS07380 (1536855) | 1536855..1536941 | + | 87 | Protein_1450 | site-specific recombinase | - |
| OLL88_RS07385 (1537084) | 1537084..1537308 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL88_RS07390 (1537323) | 1537323..1538192 | + | 870 | WP_002378351.1 | nucleotidyltransferase domain-containing protein | Toxin |
| OLL88_RS07395 (1538173) | 1538173..1538907 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| OLL88_RS07400 (1538940) | 1538940..1539803 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| OLL88_RS07405 (1539973) | 1539973..1540374 | + | 402 | WP_002401582.1 | phosphoribosyltransferase family protein | - |
| OLL88_RS07410 (1540602) | 1540602..1541921 | + | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia | - | 1504306..1541001 | 36695 | |
| - | inside | IScluster/Tn | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) | - | 1521621..1548429 | 26808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32912.50 Da Isoelectric Point: 4.7903
>T263049 WP_002378351.1 NZ_CP110072:1537323-1538192 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|