Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1240895..1241588 Replicon chromosome
Accession NZ_CP110072
Organism Enterococcus faecalis strain BE7

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag OLL88_RS05800 Protein ID WP_002378467.1
Coordinates 1240895..1241239 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL88_RS05805 Protein ID WP_002364355.1
Coordinates 1241256..1241588 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL88_RS05770 (1236169) 1236169..1237137 + 969 Protein_1131 competence type IV pilus ATPase ComGA -
OLL88_RS05775 (1237094) 1237094..1238140 + 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
OLL88_RS05780 (1238140) 1238140..1238415 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL88_RS05785 (1238412) 1238412..1238846 + 435 Protein_1134 competence type IV pilus minor pilin ComGD -
OLL88_RS05790 (1238883) 1238883..1240031 - 1149 WP_002378469.1 site-specific integrase -
OLL88_RS05795 (1240131) 1240131..1240859 - 729 WP_002378468.1 potassium channel family protein -
OLL88_RS05800 (1240895) 1240895..1241239 - 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL88_RS05805 (1241256) 1241256..1241588 - 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL88_RS05810 (1241900) 1241900..1242076 + 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL88_RS05815 (1242087) 1242087..1242398 + 312 WP_002381719.1 hypothetical protein -
OLL88_RS05820 (1242437) 1242437..1243162 + 726 WP_002378466.1 phage regulatory protein -
OLL88_RS05825 (1243188) 1243188..1243376 - 189 WP_002357001.1 YegP family protein -
OLL88_RS05830 (1243431) 1243431..1243640 + 210 WP_002378465.1 hypothetical protein -
OLL88_RS05835 (1243677) 1243677..1243871 + 195 WP_002378464.1 hypothetical protein -
OLL88_RS05840 (1244298) 1244298..1244852 - 555 WP_002357006.1 hypothetical protein -
OLL88_RS05845 (1245072) 1245072..1245389 + 318 WP_002357007.1 hypothetical protein -
OLL88_RS05850 (1245382) 1245382..1246116 + 735 WP_002378463.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1238439..1277926 39487


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T263048 WP_002378467.1 NZ_CP110072:c1241239-1240895 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT263048 WP_002364355.1 NZ_CP110072:c1241588-1241256 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References