Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1502386..1503523 | Replicon | chromosome |
Accession | NZ_CP110071 | ||
Organism | Enterococcus faecalis strain BE8 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | OLL94_RS07150 | Protein ID | WP_002401483.1 |
Coordinates | 1502660..1503523 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | OLL94_RS07145 | Protein ID | WP_000301765.1 |
Coordinates | 1502386..1502658 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL94_RS07115 (1498789) | 1498789..1500315 | + | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
OLL94_RS07120 (1500435) | 1500435..1500557 | + | 123 | Protein_1400 | peptide-binding protein | - |
OLL94_RS07125 (1500626) | 1500626..1500721 | + | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
OLL94_RS07130 (1500846) | 1500846..1501583 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
OLL94_RS07135 (1501753) | 1501753..1502013 | + | 261 | Protein_1403 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
OLL94_RS07140 (1502154) | 1502154..1502369 | + | 216 | WP_002295735.1 | peptide-binding protein | - |
OLL94_RS07145 (1502386) | 1502386..1502658 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
OLL94_RS07150 (1502660) | 1502660..1503523 | + | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
OLL94_RS07155 (1503964) | 1503964..1504281 | + | 318 | WP_002333463.1 | hypothetical protein | - |
OLL94_RS07160 (1504301) | 1504301..1504390 | + | 90 | Protein_1408 | DnaJ domain-containing protein | - |
OLL94_RS07165 (1504465) | 1504465..1505145 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
OLL94_RS07170 (1505127) | 1505127..1505363 | + | 237 | WP_264554385.1 | ketopantoate reductase C-terminal domain-containing protein | - |
OLL94_RS07175 (1505639) | 1505639..1506490 | + | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
OLL94_RS07180 (1506492) | 1506492..1507259 | + | 768 | WP_002357481.1 | ribonuclease HII | - |
OLL94_RS07185 (1507320) | 1507320..1508183 | + | 864 | WP_002382350.1 | DNA-processing protein DprA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia | - | 1461022..1497717 | 36695 | |
- | inside | IScluster/Tn | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) | - | 1478337..1505145 | 26808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T263035 WP_002401483.1 NZ_CP110071:1502660-1503523 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|