Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 1493800..1494908 | Replicon | chromosome |
| Accession | NZ_CP110071 | ||
| Organism | Enterococcus faecalis strain BE8 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | A0A193AUR0 |
| Locus tag | OLL94_RS07090 | Protein ID | WP_002378351.1 |
| Coordinates | 1494039..1494908 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | OLL94_RS07085 | Protein ID | WP_000205227.1 |
| Coordinates | 1493800..1494024 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL94_RS07065 (1489431) | 1489431..1490915 | + | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
| OLL94_RS07070 (1490969) | 1490969..1491772 | + | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| OLL94_RS07075 (1492081) | 1492081..1493382 | - | 1302 | Protein_1391 | ISL3 family transposase | - |
| OLL94_RS07080 (1493571) | 1493571..1493657 | + | 87 | Protein_1392 | site-specific recombinase | - |
| OLL94_RS07085 (1493800) | 1493800..1494024 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL94_RS07090 (1494039) | 1494039..1494908 | + | 870 | WP_002378351.1 | nucleotidyltransferase domain-containing protein | Toxin |
| OLL94_RS07095 (1494889) | 1494889..1495623 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| OLL94_RS07100 (1495656) | 1495656..1496519 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| OLL94_RS07105 (1496689) | 1496689..1497090 | + | 402 | WP_002401582.1 | phosphoribosyltransferase family protein | - |
| OLL94_RS07110 (1497318) | 1497318..1498637 | + | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia | - | 1461022..1497717 | 36695 | |
| - | inside | IScluster/Tn | str / cat / aph(3')-III / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) | - | 1478337..1505145 | 26808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32912.50 Da Isoelectric Point: 4.7903
>T263034 WP_002378351.1 NZ_CP110071:1494039-1494908 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|