Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1197611..1198304 Replicon chromosome
Accession NZ_CP110071
Organism Enterococcus faecalis strain BE8

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag OLL94_RS05500 Protein ID WP_002378467.1
Coordinates 1197611..1197955 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL94_RS05505 Protein ID WP_002364355.1
Coordinates 1197972..1198304 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL94_RS05470 (1192885) 1192885..1193853 + 969 Protein_1073 competence type IV pilus ATPase ComGA -
OLL94_RS05475 (1193810) 1193810..1194856 + 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
OLL94_RS05480 (1194856) 1194856..1195131 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL94_RS05485 (1195128) 1195128..1195562 + 435 Protein_1076 competence type IV pilus minor pilin ComGD -
OLL94_RS05490 (1195599) 1195599..1196747 - 1149 WP_002378469.1 site-specific integrase -
OLL94_RS05495 (1196847) 1196847..1197575 - 729 WP_002378468.1 potassium channel family protein -
OLL94_RS05500 (1197611) 1197611..1197955 - 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL94_RS05505 (1197972) 1197972..1198304 - 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL94_RS05510 (1198616) 1198616..1198792 + 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL94_RS05515 (1198803) 1198803..1199114 + 312 WP_002381719.1 hypothetical protein -
OLL94_RS05520 (1199153) 1199153..1199878 + 726 WP_002378466.1 phage regulatory protein -
OLL94_RS05525 (1199904) 1199904..1200092 - 189 WP_002357001.1 YegP family protein -
OLL94_RS05530 (1200147) 1200147..1200356 + 210 WP_002378465.1 hypothetical protein -
OLL94_RS05535 (1200393) 1200393..1200587 + 195 WP_002378464.1 hypothetical protein -
OLL94_RS05540 (1201014) 1201014..1201568 - 555 WP_002357006.1 hypothetical protein -
OLL94_RS05545 (1201788) 1201788..1202105 + 318 WP_002357007.1 hypothetical protein -
OLL94_RS05550 (1202098) 1202098..1202832 + 735 WP_002378463.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1195155..1244031 48876


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T263033 WP_002378467.1 NZ_CP110071:c1197955-1197611 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT263033 WP_002364355.1 NZ_CP110071:c1198304-1197972 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References