Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 11666..12200 Replicon plasmid pBE11_1
Accession NZ_CP110070
Organism Enterococcus faecalis strain BE11

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag OLL93_RS14170 Protein ID WP_002360769.1
Coordinates 11925..12200 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag OLL93_RS14165 Protein ID WP_002369771.1
Coordinates 11666..11932 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL93_RS14125 (7287) 7287..8072 + 786 WP_002385543.1 replication-relaxation family protein -
OLL93_RS14130 (8078) 8078..8455 + 378 WP_010733799.1 hypothetical protein -
OLL93_RS14135 (8966) 8966..9424 + 459 WP_244026334.1 hypothetical protein -
OLL93_RS14140 (9457) 9457..9957 + 501 WP_002360775.1 DnaJ domain-containing protein -
OLL93_RS14145 (9970) 9970..10218 + 249 WP_002369776.1 DUF3850 domain-containing protein -
OLL93_RS14150 (10294) 10294..10710 + 417 WP_002368093.1 single-stranded DNA-binding protein -
OLL93_RS14155 (10734) 10734..11318 + 585 WP_010774883.1 thermonuclease family protein -
OLL93_RS14160 (11315) 11315..11563 + 249 WP_002369773.1 hypothetical protein -
OLL93_RS14165 (11666) 11666..11932 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OLL93_RS14170 (11925) 11925..12200 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
OLL93_RS14175 (13004) 13004..13189 + 186 WP_002365983.1 hypothetical protein -
OLL93_RS14180 (13192) 13192..13365 + 174 WP_010774884.1 DpnD/PcfM family protein -
OLL93_RS14185 (13596) 13596..14375 + 780 WP_002365985.1 Cas9 inhibitor AcrIIA9 family protein -
OLL93_RS14190 (14375) 14375..15634 + 1260 WP_002365986.1 PcfJ domain-containing protein -
OLL93_RS14195 (16284) 16284..17012 + 729 WP_002383622.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..43800 43800


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-87)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T263020 WP_002360769.1 NZ_CP110070:11925-12200 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9804.15 Da        Isoelectric Point: 4.4791

>AT263020 WP_002369771.1 NZ_CP110070:11666-11932 [Enterococcus faecalis]
MATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References