Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2808622..2809193 | Replicon | chromosome |
| Accession | NZ_CP110069 | ||
| Organism | Enterococcus faecalis strain BE11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OLL93_RS13630 | Protein ID | WP_002354774.1 |
| Coordinates | 2808622..2808963 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | OLL93_RS13635 | Protein ID | WP_002354773.1 |
| Coordinates | 2808963..2809193 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL93_RS13625 (2804637) | 2804637..2808251 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| OLL93_RS13630 (2808622) | 2808622..2808963 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OLL93_RS13635 (2808963) | 2808963..2809193 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| OLL93_RS13640 (2809599) | 2809599..2809814 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| OLL93_RS13645 (2809953) | 2809953..2810945 | + | 993 | WP_002365428.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL93_RS13650 (2811012) | 2811012..2811644 | - | 633 | WP_002358972.1 | RloB family protein | - |
| OLL93_RS13655 (2811653) | 2811653..2812948 | - | 1296 | WP_002371641.1 | ATP-binding protein | - |
| OLL93_RS13660 (2812974) | 2812974..2813108 | - | 135 | WP_002391552.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T263016 WP_002354774.1 NZ_CP110069:c2808963-2808622 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|