Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2484835..2485625 | Replicon | chromosome |
| Accession | NZ_CP110069 | ||
| Organism | Enterococcus faecalis strain BE11 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | OLL93_RS12105 | Protein ID | WP_033627270.1 |
| Coordinates | 2485236..2485625 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL93_RS12100 | Protein ID | WP_002402312.1 |
| Coordinates | 2484835..2485221 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL93_RS12050 (2480531) | 2480531..2481100 | - | 570 | Protein_2344 | cell division protein FtsK | - |
| OLL93_RS12055 (2481188) | 2481188..2481568 | - | 381 | WP_002402315.1 | DUF86 domain-containing protein | - |
| OLL93_RS12060 (2481558) | 2481558..2481884 | - | 327 | WP_002394268.1 | nucleotidyltransferase domain-containing protein | - |
| OLL93_RS12065 (2481944) | 2481944..2482237 | - | 294 | WP_029655860.1 | hypothetical protein | - |
| OLL93_RS12070 (2482279) | 2482279..2482431 | - | 153 | WP_002371433.1 | hypothetical protein | - |
| OLL93_RS12075 (2482658) | 2482658..2482846 | + | 189 | WP_002371434.1 | hypothetical protein | - |
| OLL93_RS12080 (2482833) | 2482833..2482994 | - | 162 | WP_002380875.1 | hypothetical protein | - |
| OLL93_RS12085 (2483017) | 2483017..2483433 | - | 417 | WP_002380876.1 | DUF961 family protein | - |
| OLL93_RS12090 (2483433) | 2483433..2483759 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| OLL93_RS12095 (2483845) | 2483845..2484096 | - | 252 | WP_010777935.1 | hypothetical protein | - |
| OLL93_RS12100 (2484835) | 2484835..2485221 | + | 387 | WP_002402312.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL93_RS12105 (2485236) | 2485236..2485625 | + | 390 | WP_033627270.1 | hypothetical protein | Toxin |
| OLL93_RS12110 (2485893) | 2485893..2486228 | + | 336 | WP_002402309.1 | helix-turn-helix domain-containing protein | - |
| OLL93_RS12115 (2486266) | 2486266..2487597 | - | 1332 | WP_002402308.1 | FAD-dependent oxidoreductase | - |
| OLL93_RS12120 (2487696) | 2487696..2488571 | - | 876 | WP_010785430.1 | aldo/keto reductase | - |
| OLL93_RS12125 (2488648) | 2488648..2489067 | - | 420 | WP_002380882.1 | MerR family transcriptional regulator | - |
| OLL93_RS12130 (2489084) | 2489084..2489664 | - | 581 | Protein_2360 | phosphoglycerate mutase family protein | - |
| OLL93_RS12135 (2489864) | 2489864..2490213 | + | 350 | Protein_2361 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2418995..2486111 | 67116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15501.78 Da Isoelectric Point: 5.0434
>T263008 WP_033627270.1 NZ_CP110069:2485236-2485625 [Enterococcus faecalis]
VDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDEVIITTN
KELMLERKNFTKMHEVIHYYIDIPKINNATHTFSDILLKNGYLMEDFPK
VDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDEVIITTN
KELMLERKNFTKMHEVIHYYIDIPKINNATHTFSDILLKNGYLMEDFPK
Download Length: 390 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15181.05 Da Isoelectric Point: 4.7886
>AT263008 WP_002402312.1 NZ_CP110069:2484835-2485221 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|